Recombinant Crucihimalaya wallichii NAD (P)H-quinone oxidoreductase subunit 4L, chloroplastic

What is Crucihimalaya wallichii NAD(P)H-quinone oxidoreductase subunit 4L and where is it naturally found?

The NAD(P)H-quinone oxidoreductase subunit 4L (NdhE) is a chloroplastic protein encoded by the ndhE gene in Crucihimalaya wallichii (also known as Rock-cress or Arabidopsis campestris). This protein is a component of the NAD(P)H dehydrogenase complex found in chloroplasts. The complete protein consists of 101 amino acids with the sequence MILEHVLVLSAYLFLIGLYGLITSRNMVRALMCLELILNAVNMNFVTFSDFFDNSELKGDIFCIFVIAIAAAEAAIGLAIVSSIYRNRKSTRINQSTLLNK . C. wallichii is a close relative of Arabidopsis and is typically found in high-altitude regions, particularly in the Qinghai–Tibet Plateau, where it has adapted to extreme environmental conditions .

What is the role of the ndh gene family in plants?

The ndh gene family encodes components of the NAD(P)H dehydrogenase complex in chloroplasts. In higher plants, this complex is encoded by 11 genes (ndhA-K) distributed in the chloroplast genome. The complex plays important roles in:

• Cyclic electron transport in photosynthesis

• Chlororespiration

• Protection against photooxidative stress

• Adaptation to environmental stresses such as high light intensity and temperature fluctuations

Interestingly, the ndh genes show varying levels of conservation, degradation, and translocation between the chloroplast and mitochondrial genomes across different plant species, suggesting differential evolutionary pressures .

How can recombinant Crucihimalaya wallichii NdhE protein be expressed and purified?

The recombinant full-length C. wallichii NAD(P)H-quinone oxidoreductase subunit 4L is typically expressed in E. coli expression systems with an N-terminal His-tag to facilitate purification. The methodology involves:

Expression protocol:

• Clone the full coding sequence (1-101 amino acids) into an appropriate expression vector

• Transform E. coli cells with the recombinant plasmid

• Induce protein expression under optimized conditions

• Harvest cells and lyse to release the recombinant protein

Purification steps:

• Perform immobilized metal affinity chromatography (IMAC) using the His-tag

• Further purify using additional chromatographic methods if needed

• Lyophilize to obtain a stable powder form

Quality control:

• Verify purity using SDS-PAGE (typically >90% purity is achieved)

• Confirm identity using mass spectrometry or western blotting

What are the optimal storage conditions for maintaining recombinant NdhE protein stability?

To maintain optimal stability of the recombinant C. wallichii NdhE protein, the following storage conditions are recommended:

Short-term storage:

• Store working aliquots at 4°C for up to one week

Long-term storage:

• Store lyophilized product at -20°C/-80°C

• After reconstitution, add glycerol (final concentration 5-50%) and store at -20°C/-80°C

• Avoid repeated freeze-thaw cycles

Reconstitution protocol:

• Briefly centrifuge the vial before opening

• Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

• Aliquot to minimize freeze-thaw cycles

The recommended storage buffer is Tris/PBS-based buffer with 6% Trehalose, pH 8.0, though the specific buffer may vary based on the protein's intended use .

How does the translocation of ndh genes between chloroplast and mitochondrial genomes occur in plants?

The translocation of ndh genes between chloroplast and mitochondrial genomes represents a fascinating evolutionary phenomenon observed in multiple plant lineages. Based on the current research:

• Transfer mechanisms:

  • DNA transfer likely occurs through direct physical contact between organelles

  • Double-strand break repair mechanisms may facilitate integration into recipient genomes

  • Transposable elements might mediate some transfers

• Patterns observed in research studies:

  • In Orchidaceae, multiple non-chloroplast ndh gene fragments have been identified in mitochondrial genomes

  • In Epidendroideae orchids like E. pusilla, up to 10 ndh genes (in six fragments) were transferred to the mitochondrial genome

  • Transferred ndh genes often show truncations or large deletions

• Evolutionary implications:

  • The number of transferred ndh gene fragments does not necessarily correlate with ndh deletions in the chloroplast genome

  • Some species maintain complete ndh profiles in chloroplasts while also having copies in the mitochondrial genome

  • Transfers may occur either before or after ndh gene degradation in the chloroplast

This research demonstrates that interorganellar gene transfer is an ongoing evolutionary process in plants, with significant variation across lineages .

What molecular adaptations in ndh genes are associated with high-altitude environments?

Plants growing in high-altitude environments like the Qinghai-Tibet Plateau face extreme conditions including intense UV radiation, low temperatures, and reduced pathogen pressure. Crucihimalaya species have evolved specific adaptations that may involve ndh genes:

Adaptive features observed in Crucihimalaya species:

• Gene family adaptations:

  • Significant contraction in disease resistance gene families (likely due to pathogen-depauperate environments)

  • Expansion in gene families associated with:

    • Ubiquitin-mediated proteolysis

    • DNA repair mechanisms

• Molecular adaptations:

  • Positive selection in genes involved in DNA repair pathways

  • Modifications in genes related to ubiquitin-mediated proteolysis

  • Alterations in reproductive process genes

  • Potential modifications in photosynthetic machinery to optimize function in high light/low temperature conditions

• Evolutionary timeline:

  • Many adaptations coincided with the dramatic uplift of the Himalayas (Late Pliocene to Pleistocene)

  • LTR retrotransposon proliferation occurred during this period, potentially facilitating adaptive changes

These adaptations likely contribute to C. wallichii's ability to thrive in high-altitude environments with intense radiation and temperature extremes .

How does NdhE protein structure and function vary across the Brassicaceae family?

NdhE (NAD(P)H-quinone oxidoreductase subunit 4L) shows interesting patterns of conservation and variation across Brassicaceae species:

Structural conservation:

Functional implications:

• The high sequence conservation suggests critical functional importance across Brassicaceae

• Transmembrane domains are particularly conserved, reflecting the protein's role in the thylakoid membrane

• Minor variations in amino acid sequences may relate to environmental adaptations specific to each species' habitat

Research utilizing antibodies against NdhE shows cross-reactivity across multiple Brassicaceae species, including Arabidopsis thaliana, Brassica napus, and predicted reactivity with Crucihimalaya wallichii, further confirming the structural conservation of this protein .

What patterns of ndh gene degradation are observed across plant species and what are their evolutionary implications?

The ndh gene family shows fascinating patterns of degradation across plant lineages, providing insights into evolutionary processes:

Degradation patterns:

• Orchidaceae family:

  • Variable degradation of ndh genes across subfamilies

  • Some species (e.g., Neuwiedia malipoensis, Cymbidium sinense) retain all 11 ndh genes

  • Others (e.g., Vanilla species, Epidendroideae) retain fewer than 5 ndh genes

  • Frequent large deletions in directly repeated or AT-rich regions

  • Four variants of the ycf1-rpl32 region (which normally includes ndhF) identified in Cymbidium species

• Other plant families:

  • Complete ndh gene sets in most photosynthetic angiosperms

  • Selective loss in some lineages (e.g., gymnosperms, some parasitic plants)

  • Degradation patterns often lineage-specific

Evolutionary implications:

• Independent loss events across plant phylogeny suggest lack of selective pressure in certain environments

• Retention in most photosynthetic plants indicates functional importance under natural conditions

• Gene transfer to mitochondrial genome may precede deletion from chloroplast

• Population-level variation in ndh gene degradation suggests ongoing evolutionary processes

• Degradation patterns may correlate with specific ecological adaptations

These findings suggest that ndh genes may be dispensable under certain environmental conditions, allowing for their degradation or loss, while their conservation in most plants indicates important functional roles in natural environments .

What immunological tools are available for detecting NdhE protein in experimental studies?

Several immunological tools are available for researchers studying NdhE proteins:

Available antibodies:

• Anti-NdhE (NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic):

  • Format: Lyophilized antibodies

  • Host organisms: Primarily rabbit polyclonal antibodies

  • Applications: Western blot analyses, immunolocalization studies

  • Recommended dilutions: Typically 1:1000 for Western blot applications

• Cross-reactivity profile:

  • Confirmed reactivity with Arabidopsis thaliana, Spinacia oleracea

  • Predicted reactivity with multiple species including Crucihimalaya wallichii, Brassica species, and other Brassicaceae

  • Usually not reactive with cyanobacteria or moss (Physcomitrella patens)

Methodological considerations:

• Protein extraction protocols:

  • Use specialized buffer systems for membrane protein extraction

  • Gentle detergents like dodecyl maltoside often preserve protein structure

  • Consider enrichment of chloroplast fractions for improved detection

• Detection systems:

  • Chemiluminescence provides sensitive detection for Western blots

  • Fluorescent secondary antibodies allow for quantitative analysis

  • For co-localization studies, consider using organelle-specific markers

These immunological tools enable researchers to study NdhE protein expression, localization, and function in various plant species, including Crucihimalaya wallichii .

What genomic approaches are recommended for investigating ndh gene evolution in newly sequenced plant genomes?

For researchers investigating ndh gene evolution in newly sequenced plant genomes, several genomic approaches are recommended:

Sequence identification and annotation:

• Homology-based approaches:

  • BLAST searches using known ndh sequences as queries

  • Profile hidden Markov models (HMMs) for sensitive detection of distant homologs

  • Combined approaches using both nucleotide and protein sequence comparisons

• Structural annotation tools:

  • Gene prediction algorithms optimized for organellar genomes

  • RNA-seq data integration to confirm gene expression and splicing

  • Manual curation to verify gene models, especially for pseudogenes

Evolutionary analysis methods:

• Comparative genomic approaches:

  • Synteny analysis to identify genomic rearrangements

  • Identification of direct repeats that may facilitate deletions

  • Analysis of AT-rich regions prone to recombination and deletion

• Phylogenetic approaches:

  • Reconstruction of gene trees to identify orthologous relationships

  • Reconciliation with species trees to detect duplication and loss events

  • Tests for selective pressure (dN/dS ratios) to identify adaptive evolution

• Organellar genome comparisons:

  • Targeted sequencing of both chloroplast and mitochondrial genomes

  • Integration of whole-genome sequencing data to identify nuclear transfers

  • Long-read sequencing technologies to resolve complex structural variants

These approaches have been successfully applied in studies of orchids and other plant families to characterize the complex evolutionary history of ndh genes, including degradation patterns and interorganellar gene transfers .

How can researchers resolve contradictory data regarding ndh gene functionality across species?

Contradictory data regarding ndh gene functionality across species presents significant research challenges. To address these contradictions, researchers should consider:

Methodological approaches:

• Multi-omics integration:

  • Combine genomic, transcriptomic, and proteomic data

  • Compare gene presence with transcript and protein expression

  • Example: In Vanilla planifolia, only ndhB was found in the chloroplast genome, but ndhK, J, and C transcripts were identified in the whole-cell transcriptome

• Functional validation experiments:

  • Gene knockout/knockdown studies in model species

  • Heterologous expression and complementation assays

  • Measurement of NAD(P)H dehydrogenase activity using specific substrates and inhibitors

• Evolutionary context considerations:

  • Reconstruct ancestral states to identify independent loss events

  • Consider environmental adaptations that might explain functional redundancy

  • Examine correlation between ndh gene status and ecological parameters

Case studies illustrating resolution approaches:

• Orchidaceae family:

  • Contradictions in ndh gene presence/absence were resolved by:

    • Targeted sequencing of both chloroplast and mitochondrial genomes

    • Transcriptome analysis to identify expressed genes regardless of genomic location

    • Phylogenetic analysis to establish independent loss events

• Crucihimalaya species:

  • Disagreements in adaptive significance were addressed through:

    • Comparative genomics across related species

    • Positive selection analysis to identify adaptive changes

    • Correlation with environmental adaptations to high-altitude environments

These approaches can help researchers resolve contradictory data and develop more accurate models of ndh gene evolution and function across plant species .

What are the current challenges in expressing and studying chloroplast membrane proteins like NdhE in heterologous systems?

Expressing and studying chloroplast membrane proteins like NdhE in heterologous systems presents several challenges:

Expression system challenges:

• Prokaryotic systems (E. coli):

  • Codon usage differences can limit expression efficiency

  • Membrane insertion machinery differs from chloroplasts

  • Post-translational modifications may be absent

  • Protein may form inclusion bodies requiring refolding

• Eukaryotic systems (yeast, insect cells):

  • Chloroplast targeting sequences may not be recognized

  • Membrane composition differs from thylakoid membranes

  • Assembly with other subunits may be impaired

  • Expression levels are often lower than in prokaryotic systems

Methodological solutions:

• Optimizing expression:

  • Codon optimization for the host organism

  • Addition of solubility tags (e.g., MBP, SUMO)

  • Use of specialized strains with enhanced membrane protein expression

  • Co-expression with chaperones to aid folding

• Purification strategies:

  • Gentle detergent extraction to maintain native conformation

  • Lipid nanodiscs or amphipols to stabilize membrane proteins

  • Affinity tags positioned to minimize interference with function

  • Size exclusion chromatography to verify oligomeric state

• Functional characterization:

  • Reconstitution into liposomes for activity assays

  • Solid-state NMR or cryo-EM for structural studies

  • Site-directed mutagenesis to identify critical residues

  • In vitro electron transport assays with suitable electron donors/acceptors

By addressing these challenges, researchers can better study the structure, function, and interactions of NdhE and other components of the NAD(P)H dehydrogenase complex in chloroplasts .

How might understanding NdhE function contribute to engineering stress-resilient crops?

Understanding the function of NdhE and the broader NAD(P)H dehydrogenase complex could significantly contribute to engineering stress-resilient crops:

Potential applications:

• Enhanced photoprotection:

  • Engineering optimized cyclic electron flow to reduce photooxidative damage

  • Improving plant performance under fluctuating light conditions

  • Reducing photoinhibition during drought or temperature stress

• High-altitude adaptation:

  • Transferring adaptations from Crucihimalaya species to crops

  • Enhancing tolerance to high UV radiation environments

  • Improving photosynthetic efficiency at low temperatures

• Climate resilience mechanisms:

  • Modulating NDH complex activity to enhance adaptation to specific stressors

  • Fine-tuning the balance between linear and cyclic electron transport

  • Creating regulatory switches responsive to environmental conditions

Research strategies:

• Comparative functional studies:

  • Analyze NDH complex composition and activity across species with different stress tolerances

  • Compare NdhE from high-altitude adapted species (like Crucihimalaya) with crop relatives

  • Identify specific amino acid changes that confer enhanced stress resilience

• Genetic engineering approaches:

  • Targeted engineering of NdhE to enhance complex stability or activity

  • Optimization of the entire NDH complex through multigene engineering

  • Use of synthetic biology approaches to create novel regulatory circuits

This research direction holds promise for developing crops with enhanced resilience to climate change-related stresses, particularly for high-altitude agriculture or regions experiencing increased temperature and light stress .

What insights might be gained from studying ndh gene loss and transfer in the context of organellar genome co-evolution?

Studying ndh gene loss and transfer provides a unique window into organellar genome co-evolution and offers several promising research directions:

Theoretical frameworks:

• Organellar genome dynamics:

  • Patterns of gene loss and retention may reveal selective constraints on organellar genomes

  • Transfer events illuminate mechanisms of interorganellar DNA exchange

  • The fate of transferred genes (functional retention vs. pseudogenization) provides insights into selection pressures

• Genome co-evolution models:

  • Coordination between nuclear, chloroplast, and mitochondrial genomes

  • Compensatory changes in one genome responding to changes in another

  • Evolution of regulatory networks spanning multiple genomes

Research opportunities:

• Mechanistic studies:

  • Investigate the molecular mechanisms facilitating DNA transfer between organelles

  • Explore the role of direct organelle contacts in gene transfer

  • Study DNA repair and integration mechanisms in recipient genomes

• Functional investigations:

  • Compare the function of ndh genes in their original vs. transferred locations

  • Examine changes in expression patterns following transfer

  • Investigate whether transferred genes acquire new functions

• Evolutionary implications:

  • Explore the role of ndh gene transfers in plant adaptation to new environments

  • Investigate whether transfer events correlate with major evolutionary transitions

  • Examine the relationship between genome size, gene content, and organellar function

This research area offers significant potential for advancing our understanding of genome evolution, gene transfer mechanisms, and the complex interplay between different genetic compartments in plant cells .