Recombinant Crucihimalaya wallichii Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Photosynthesis

CP47 acts as an inner antenna complex, optimizing light harvesting and stabilizing PSII superstructures:

  • PSII Assembly: Associates with D1/D2 reaction center proteins and cytochrome b559 during early PSII biogenesis .

  • Light-Harvesting: Binds chlorophyll and β-carotene, enabling energy transfer to the reaction center .

  • Stress Response: Mutant studies in Arabidopsis reveal reduced PSII-LHCII supercomplex stability under high light, highlighting its role in photoprotection .

Table 2: Functional Deficits in CP43/CP47 Mutants

ParameterWild-Typepsb33-1 Mutant
Chlorophyll a/b Ratio3.4 ± 0.013.2 ± 0.29*
Maximal PSII Quantum Yield0.83 ± 0.010.78 ± 0.01*
Nonphotochemical Quenching1.15 ± 0.050.56 ± 0.07*
Data adapted from Arabidopsis studies .

Research Applications

Recombinant CP47 enables mechanistic studies of PSII:

  • Biochemical Assays: Used to isolate PSII subcomplexes and analyze pigment-protein interactions .

  • Structural Studies: Facilitates cryo-EM and X-ray crystallography to resolve PSII architecture .

  • Stress Tolerance Screening: Mutants with disrupted CP47 help identify genes involved in photodamage repair .

Comparative Analysis with Homologs

CP47 homologs across species share conserved roles but exhibit functional variations:

  • Synechocystis sp. PCC 6803: Binds PsbH and PsbT during assembly .

  • Spinacia oleracea (Spinach): 98% sequence identity with C. wallichii CP47, differing in 10 AA residues .

  • Chlamydomonas reinhardtii: PsbK co-purifies with CP43, suggesting auxiliary protein partnerships .

Technical Considerations for Use

  • Purity: >90% by SDS-PAGE, requiring rigorous quality control for functional assays .

  • Reconstitution: Lyophilized powder must be dissolved in Tris/PBS buffer with glycerol to prevent aggregation .

Future Directions

  • Far-Red Adaptation: Engineering CP47 with alternative chlorophylls (e.g., Chl-f/d) could expand light absorption spectra .

  • Crop Improvement: Insights into CP47-driven PSII resilience may inform strategies for enhancing photosynthetic efficiency under stress .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for the estimated delivery time.
Note: Our standard shipping includes blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life of the product depends on various factors, including storage conditions, buffer components, storage temperature, and the intrinsic stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us. We will prioritize developing the specified tag if possible.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Crucihimalaya wallichii (Rock-cress) (Arabidopsis campestris)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLLSVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWNITGGTITNPGLWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL EIFCDERTGKPSLDLPKIFGIHLFLSGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQP VNPAWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSAGLAENQSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPVFRNKEGRELFVRRMP TFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGAFQKLGDPTTKRQAV
Uniprot No.

Target Background

Function
Crucihimalaya wallichii Photosystem II CP47 chlorophyll apoprotein (psbB) is a key component of the photosystem II (PSII) core complex. It binds chlorophyll and plays a crucial role in catalyzing the primary light-induced photochemical processes of PSII. PSII is a light-driven water:plastoquinone oxidoreductase that utilizes light energy to extract electrons from H2O, generating O2 and a proton gradient, which is subsequently used for ATP formation.
Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Crucihimalaya wallichii Photosystem II CP47 chlorophyll apoprotein (psbB)?

Crucihimalaya wallichii Photosystem II CP47 chlorophyll apoprotein (psbB) is an integral membrane protein that functions as a core antenna component of Photosystem II (PSII) in chloroplasts. The protein is encoded by the psbB gene located in the chloroplast genome. CP47 contains multiple chlorophyll molecules that absorb light energy and transfer excitation to the PSII reaction center, playing a critical role in the initial stages of photosynthesis . In Crucihimalaya wallichii, a member of the Brassicaceae family, the protein shares significant homology with other CP47 proteins found across photosynthetic organisms but contains species-specific variations that may reflect evolutionary adaptations .

What is the structural organization of CP47 and how does it contribute to PSII function?

CP47 is a large transmembrane protein that spans the thylakoid membrane with six membrane-spanning α-helices. The protein binds approximately 16 chlorophyll molecules, which are strategically positioned to facilitate efficient excitation energy transfer. Research utilizing quantum mechanics/molecular mechanics (QM/MM) approaches has revealed that the protein environment significantly influences the excitation energies of the bound chlorophylls, with the most red-shifted chlorophylls (B3, followed by B1) serving as low-energy sinks that direct energy flow toward the reaction center . This structural arrangement ensures that light energy captured by CP47 is efficiently transferred to the PSII reaction center, where charge separation initiates the photosynthetic electron transport chain.

What are the recommended protocols for expressing recombinant Crucihimalaya wallichii psbB protein?

Based on successful protocols for similar proteins, recombinant Crucihimalaya wallichii psbB protein can be expressed in E. coli expression systems using the following optimized protocol:

  • Gene Synthesis and Cloning:

    • Synthesize the psbB gene (encoding amino acids 1-508) with codon optimization for E. coli

    • Clone into a suitable expression vector (e.g., pET series) with an N-terminal His-tag

    • Transform into E. coli BL21(DE3) or Rosetta(DE3) strains

  • Expression Conditions:

    • Culture bacteria in LB or 2xYT medium at 37°C until OD600 reaches 0.6-0.8

    • Induce with 0.5-1.0 mM IPTG

    • Shift temperature to 18-20°C and continue expression for 16-18 hours

    • Supplement with 5-aminolevulinic acid (0.5 mM) to enhance chlorophyll synthesis if co-expression with chlorophyll assembly systems is desired

  • Protein Purification:

    • Lyse cells in Tris/PBS-based buffer (pH 8.0) containing 6% Trehalose

    • Purify using immobilized metal affinity chromatography

    • Perform size exclusion chromatography for higher purity

    • Store at -20°C/-80°C with 50% glycerol to prevent freeze-thaw damage

This protocol has been found to produce functional protein with greater than 90% purity as determined by SDS-PAGE analysis.

What analytical methods are most appropriate for characterizing recombinant CP47 protein structure and function?

Multiple complementary techniques should be employed to thoroughly characterize recombinant CP47:

Analytical MethodPurposeKey Parameters
Absorption SpectroscopyAssess chlorophyll bindingPeaks at 436 nm and 672 nm
Circular DichroismEvaluate secondary structureα-helical content (negative bands at 208 and 222 nm)
Fluorescence SpectroscopyMeasure excitation energy transferEmission maximum at 680 nm, excitation at 436 nm
Time-Resolved FluorescenceDetermine energy transfer kineticsPicosecond to nanosecond timescale
QM/MM CalculationsModel chlorophyll site energiesRange-separated DFT functionals

Time-dependent density functional theory (TD-DFT) with modern range-separated functionals has proven particularly effective for computing the excitation energies of CP47 chlorophylls and quantifying the electrostatic effects of the protein environment on these energies . This computational approach complements experimental spectroscopic methods and provides insights into the electronic properties of chlorophyll molecules within the protein matrix.

How can site-directed mutagenesis be used to investigate structure-function relationships in CP47?

Site-directed mutagenesis offers a powerful approach to probe the functional importance of specific amino acid residues in CP47. Based on computational predictions and sequence conservation analysis, researchers can target:

  • Chlorophyll Binding Sites:

    • Histidine residues that coordinate chlorophyll Mg2+ ions

    • Hydrophobic residues that stabilize chlorophyll phytyl chains

    • Polar residues that form hydrogen bonds with chlorophyll substituents

  • Interhelical Interactions:

    • Residues at helix-helix interfaces that maintain tertiary structure

    • Amino acids involved in salt bridges or hydrogen bond networks

  • Interfaces with Other PSII Subunits:

    • Residues mediating interactions with the reaction center

    • Contact points with other antenna proteins

A systematic mutagenesis approach should involve:

  • Conservative substitutions to probe specific interactions

  • Biophysical characterization of mutants using spectroscopic methods

  • Functional assessment through reconstitution experiments

  • Thermal stability measurements to evaluate structural impacts

Research has shown that mutations affecting the most red-shifted chlorophylls (B3 and B1) have the most pronounced effects on energy transfer efficiency, highlighting their critical role in directing excitation energy toward the reaction center .

What is the evolutionary significance of CP47 sequence variations among Brassicaceae species?

Comparative analysis of CP47 sequences across Brassicaceae reveals patterns of conservation and divergence that reflect evolutionary processes:

  • Phylogenetic Relationships:

    • CP47 sequences serve as valuable markers for resolving evolutionary relationships within Brassicaceae

    • The psbB gene has been used alongside other chloroplast genes to establish phylogenetic trees with high support values

  • Selection Pressures:

    • Analysis of nonsynonymous to synonymous substitution ratios indicates that psbB is generally under purifying selection

    • Twelve chloroplast genes, potentially including psbB, have shown signatures of positive selection at the family-wide level in Brassicaceae

  • Structural Conservation:

    • Transmembrane regions show higher sequence conservation than stromal or lumenal loops

    • Chlorophyll binding sites are particularly well conserved, reflecting their functional importance

  • Coevolution with Nuclear Genes:

    • CP47 variations may coevolve with nuclear-encoded interaction partners

    • This coevolution can contribute to incompatibilities between nuclear and chloroplast genomes from different species, potentially leading to plastid-genome incompatibility (PGI) as observed in other plant systems

The clpP/psbB spacer region has been identified as particularly variable and potentially important for species differentiation in some plant lineages . This non-coding region may influence the expression of both flanking genes.

What strategies can optimize the functional reconstitution of CP47 with chlorophylls?

Successful functional reconstitution of CP47 with chlorophylls requires careful attention to several critical factors:

  • Chlorophyll Preparation:

    • Use freshly prepared chlorophyll a extracted from spinach or commercially sourced

    • Verify purity by HPLC and absorption spectroscopy

    • Store in anhydrous solvents under nitrogen at -80°C

  • Reconstitution Buffer Optimization:

    • Detergent selection is critical (recommended: n-dodecyl-β-D-maltoside at 0.03-0.05%)

    • Include lipids (MGDG and DGDG at 0.01-0.02%) to stabilize protein structure

    • Maintain pH between 7.5-8.0 and ionic strength at 100-150 mM

    • Add antioxidants (5 mM sodium ascorbate) to prevent chlorophyll oxidation

  • Reconstitution Protocol:

    • Add chlorophylls dissolved in ethanol dropwise to detergent micelles

    • Mix with purified protein at a molar ratio of 20:1 (chlorophyll:protein)

    • Incubate at 4°C for 12-24 hours with gentle rotation

    • Remove unbound chlorophylls by sucrose gradient ultracentrifugation or size exclusion chromatography

  • Functional Verification:

    • Absorption spectrum should show characteristic peaks at 436 and 672 nm

    • Circular dichroism spectrum should confirm proper protein folding

    • Fluorescence emission at 680 nm should indicate correct chlorophyll binding

The reconstitution efficiency typically ranges from 60-80% for optimized protocols, with higher efficiencies correlating with freshly purified protein preparations.

How can researchers troubleshoot common issues with recombinant CP47 expression and purification?

IssuePotential CausesTroubleshooting Approaches
Low expression yieldProtein toxicity, codon biasUse tightly controlled induction systems, optimize codon usage, lower expression temperature
Inclusion body formationImproper folding, high expression rateExpress at lower temperatures (16-18°C), reduce IPTG concentration, co-express chaperones
Poor protein solubilityHydrophobic transmembrane domainsUse mild detergents (DDM, LMNG), include glycerol and stabilizing agents in buffers
Degradation during purificationProtease activityAdd protease inhibitors, work at 4°C, minimize purification time
Loss of activity after storageProtein denaturation, oxidationStore with 50% glycerol at -80°C, avoid repeated freeze-thaw cycles

When working with recombinant CP47, researchers should pay particular attention to protein stability during purification. The lyophilized powder form provides greater stability for long-term storage, but proper reconstitution is essential. Following reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL, addition of 5-50% glycerol (final concentration) is recommended before aliquoting for long-term storage at -20°C/-80°C .

How should researchers interpret spectroscopic data from CP47 experiments?

Interpretation of spectroscopic data from CP47 requires consideration of several key factors:

  • Absorption Spectroscopy Analysis:

    • The Qy band position (670-680 nm) is sensitive to protein environment

    • Peak ratios between Soret (~436 nm) and Qy bands indicate chlorophyll integrity

    • Peak shifts compared to free chlorophyll reflect protein-pigment interactions

    • Broadening of absorption bands suggests heterogeneity in chlorophyll binding sites

  • Fluorescence Data Interpretation:

    • Emission maxima at ~680 nm confirm proper chlorophyll binding

    • Fluorescence quantum yield reflects efficiency of excitation energy transfer

    • Excitation spectra should match absorption profiles if all chlorophylls contribute to emission

    • Fluorescence lifetime components provide insights into energy transfer pathways

  • Circular Dichroism:

    • Signals in visible region (400-700 nm) arise from exciton coupling between chlorophylls

    • Near-UV signals (250-350 nm) reflect tertiary structure around aromatic residues

    • Far-UV signals (190-250 nm) quantify secondary structure elements

Advanced computational approaches using quantum mechanics/molecular mechanics (QM/MM) with time-dependent density functional theory can help interpret experimental spectroscopic data by calculating theoretical excitation energies for comparison . This has revealed that the protein environment can shift chlorophyll excitation energies by up to 10 nm, with the most red-shifted chlorophylls (B3, followed by B1) serving as energy traps that direct excitation toward the reaction center.

What considerations are important when comparing CP47 from different species?

When conducting comparative studies of CP47 from different species such as Crucihimalaya wallichii and other Brassicaceae or more distant relatives:

  • Sequence Alignment Considerations:

    • Use structure-guided alignments that account for conserved functional domains

    • Pay special attention to chlorophyll binding sites and transmembrane regions

    • Consider both amino acid identity and physiochemical property conservation

  • Experimental Design for Comparative Studies:

    • Standardize expression and purification protocols across proteins

    • Use identical buffer conditions and analytical methods

    • Include well-characterized reference proteins (e.g., from model organisms)

  • Evolutionary Context:

    • Consider the phylogenetic relationships between species

    • Account for different selective pressures in different lineages

    • Evaluate codon usage differences that may affect heterologous expression

  • Functional Implications:

    • Assess whether sequence differences affect chlorophyll binding affinity

    • Determine if variations influence excitation energy transfer efficiency

    • Evaluate potential impacts on interactions with other PSII components

Comparative analysis of CP47 sequences has contributed significantly to resolving phylogenetic relationships within Brassicaceae, with genome-wide chloroplast analysis confirming three major lineages (I-III) with high support values . The positioning of chlorophyll molecules within CP47 is highly conserved across species, reflecting their critical role in light harvesting and energy transfer to the PSII reaction center.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.