Recombinant Crucihimalaya wallichii Photosystem Q (B) protein

Shipped with Ice Packs
In Stock

Description

Biochemical Properties and Stability

  • Storage Conditions: Lyophilized powder stable at -20°C/-80°C; reconstituted aliquots stored at 4°C for ≤1 week .

  • Purity: >90% verified via SDS-PAGE .

  • Buffer Composition: Tris/PBS-based buffer with 6% trehalose (pH 8.0) .

Repeated freeze-thaw cycles are discouraged due to potential denaturation .

Functional Role in Photosystem II

The Photosystem Q(B) protein is integral to PSII’s electron transport chain (ETC):

  • Q<sub>B</sub> Binding: Acts as the secondary plastoquinone acceptor, enabling electron transfer from Q<sub>A</sub> to the plastoquinone pool .

  • Photoprotection: Stabilizes Q<sub>A</sub>⋅<sup>–</sup> under high light, preventing harmful charge recombination and singlet oxygen formation .

  • Interaction with NH-Fe: Coordinates with a bicarbonate ligand near the NH-Fe center, which is critical for redox tuning .

Applications in Research

This recombinant protein is utilized in:

  • Photosynthesis Studies: Investigating Q<sub>B</sub> binding kinetics, electron transport efficiency, and photoinhibition mechanisms .

  • Enzyme Activity Assays: Measuring plastoquinone reduction rates under varying light conditions .

  • Structural Biology: Serving as a template for cryo-EM studies to resolve PSII assembly intermediates .

Comparative Analysis with Homologs

The C. wallichii Q(B) protein shares functional similarities with homologs like Prochlorococcus marinus PsbA (UniProt A8G5N5) , but differs in:

  • Sequence Variations: Distinct N-terminal residues (e.g., MTAILER vs. MTTIQQQR) .

  • Thermostability: C. wallichii’s protein is optimized for terrestrial plant PSII, unlike marine cyanobacterial variants .

Research Limitations and Future Directions

Current studies on this recombinant protein are primarily limited to structural and in vitro functional analyses. Further work is needed to:

  • Characterize its role in vivo within C. wallichii’s PSII.

  • Explore mutagenesis effects on Q<sub>B</sub> binding affinity.

  • Validate interactions with assembly factors like Psb28 or Psb27 .

Product Specs

Form
Lyophilized powder Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates. Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process. The tag type is finalized during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Crucihimalaya wallichii (Rock-cress) (Arabidopsis campestris)
Target Names
psbA
Target Protein Sequence
MTAILERRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDI DGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFL LGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGF NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function

Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase. It utilizes light energy to extract electrons from H₂O, generating O₂ and a proton gradient used for ATP synthesis. PSII comprises a core antenna complex for photon capture and an electron transfer chain converting photonic excitation into charge separation. The D1/D2 (PsbA/PsbD) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors.

Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the functional role of the QB site in Photosystem II?

The QB site in Photosystem II serves as the binding location for plastoquinone (PQ), which accepts electrons during photosynthetic electron transport. The exchangeable quinone at the QB site is reduced to plastohydroquinone (PQH2) through sequential electron transfers, after which it is released into the thylakoid membrane to join the plastoquinone pool. This process is essential for linking the light reactions to the electron transport chain. The thermodynamic properties of the QB site, including the midpoint potentials (Em) of the QB in its different redox forms, significantly influence electron transfer efficiency through PSII .

How does the redox state of QB influence photoinhibition mechanisms?

The redox state of QB plays a critical role in determining susceptibility to photoinhibition. Research shows a statistically significant relationship between QA redox state (measured as qL) and photoinhibition (qI), with light intensity and qE (energy-dependent quenching) acting as significant interacting factors (ANOVA, p=2×10⁻¹⁶) . When electron transfer through the cytochrome b6f complex is slowed by high proton motive force (pmf), electrons can accumulate on PSII acceptors including QB. This accumulation increases the probability of charge recombination reactions that generate reactive oxygen species and contribute to photodamage .

What protective mechanisms counteract QB-associated photodamage?

Plants have evolved multiple protective mechanisms against QB-associated photodamage:

  • Energy-dependent quenching (qE) - Dissipates excess excitation energy as heat

  • State transitions (qT) - Redistributes excitation energy between PSII and PSI

  • PSII repair systems - Specialized proteins recognize and repair damaged PSII components

In Chlamydomonas reinhardtii, both qE and qT operate synergistically during high light stress, with LHCSR3 (a key qE effector) migrating between photosystems during state transitions . In Arabidopsis, proteins like HYPERSENSITIVE TO HIGH LIGHT1 (HHL1) and LOW QUANTUM YIELD OF PHOTOSYSTEM II1 (LQY1) form a complex involved in the repair and reassembly of PSII after photodamage .

What techniques should be employed to characterize QB redox properties in recombinant photosystem proteins?

To characterize QB redox properties in recombinant photosystem proteins, researchers should implement a multi-faceted approach:

  • Spectroelectrochemical measurements to determine midpoint potentials (Em) of QB in different redox states

  • Chlorophyll fluorescence techniques to assess electron transport through QB

  • Flash-induced oxygen evolution patterns to analyze QB reduction kinetics

  • Thermoluminescence to examine charge recombination pathways involving QB

These techniques can be complemented with site-directed mutagenesis of amino acids surrounding the QB pocket to investigate structure-function relationships. In isolated thylakoid preparations, researchers can manipulate the membrane potential (Δψ) using ionophores like gramicidin to study its influence on QB function .

How can researchers effectively measure photoinhibition related to QB function?

Photoinhibition related to QB function can be measured through several complementary approaches:

  • Track the maximum PSII quantum efficiency (Fv/Fm) decline under high light

  • Measure PSII charge separation capacity using specialized fluorescence techniques

  • Quantify D1 protein levels through immunoblotting (Western blotting)

  • Distinguish between photodamage and repair limitations using chloroplast translation inhibitors like lincomycin

In experimental systems, researchers have successfully differentiated photodamage from repair limitations by comparing the rate of Fv/Fm decline in the presence and absence of lincomycin, which blocks the PSII repair cycle. This approach revealed that decreased ATP synthase activity in Arabidopsis mutants led to increased rates of PSII photodamage rather than decreased repair rates .

What experimental designs best elucidate the relationship between membrane potential and QB-mediated photodamage?

To investigate the relationship between membrane potential (Δψ) and QB-mediated photodamage, researchers should consider these experimental approaches:

  • Generate defined membrane potentials in isolated thylakoids using artificial electron donors/acceptors

  • Compare photodamage rates under conditions that generate similar electron flow but different membrane potentials

  • Use spectroscopic techniques to simultaneously monitor Δψ (using electrochromic shift) and charge recombination rates

  • Manipulate the partitioning of proton motive force between ΔpH and Δψ components

Studies with spinach thylakoids demonstrated that elevated Δψ increased the rate of charge recombination from the S2QA⁻ state by approximately 30% compared to samples where Δψ was dissipated with gramicidin . This experimental approach clearly established the causal relationship between membrane potential and recombination-mediated photodamage.

How do specific amino acid residues surrounding the QB pocket influence its susceptibility to photoinhibition?

The amino acid environment surrounding the QB pocket plays a crucial role in determining electron transfer kinetics, binding affinity, and susceptibility to photoinhibition. Specific residues influence:

  • The redox potential of QB and the equilibrium constant for electron sharing between QA and QB

  • Proton access channels necessary for QB reduction and protonation

  • The probability of harmful charge recombination pathways

Research suggests that the QB site architecture has evolved to balance efficient forward electron transfer with minimized back-reactions. The positioning of QB relative to the membrane dielectric affects how strongly membrane potential (Δψ) influences recombination pathways. Studies correlating photoinhibition (qI) with estimated recombination rates through P⁺Pheo⁻ (considering QA redox state and Δψ effects) found that this relationship explains a large fraction of observed photoinhibition across different mutants and light intensities .

What molecular mechanisms connect proton motive force (pmf) with PSII photoinhibition?

The connection between proton motive force (pmf) and PSII photoinhibition involves several interconnected mechanisms:

  • The electrical component of pmf (Δψ) accelerates photodamage by favoring recombination reactions within PSII that generate reactive oxygen species

  • High pmf slows electron transfer through the cytochrome b6f complex, causing electron accumulation on PSII acceptors

  • Excessive pmf can paradoxically decrease photoprotective qE at very high light intensities due to photoinhibition limiting lumen acidification

Studies with Arabidopsis mutants (minira lines) with altered rates of thylakoid lumen proton efflux demonstrated that decreasing ATP synthase activity increased PSII photodamage rather than decreasing repair rates. This contradicts models positing that photoinhibition is controlled primarily through modulation of repair rates . The relationship between pmf and photoinhibition is particularly important for understanding how photosynthetic organisms respond to fluctuating light environments.

What are the evolutionary differences in QB-associated photoprotection mechanisms across photosynthetic species?

Photoprotection mechanisms associated with QB function show significant evolutionary divergence across photosynthetic species:

Species GroupPrimary Photoprotection StrategiesSpecialized Proteins
CyanobacteriaPBS decoupling, OCP-dependent quenchingPROCESSING ASSOCIATED TPR PROTEIN, Slr0286, Slr2013
Green algae (C. reinhardtii)Combined qE and qT mechanismsLHCSR3 (key qE effector)
Land plants (Arabidopsis)Predominantly qE-basedPsbS, LQY1, HHL1

Land plants have evolved specialized proteins absent in cyanobacteria, such as LOW PSII ACCUMULATION1 (LPA1)/PSII REPAIR27, LPA2, and the small thylakoid zinc-finger protein LOW QUANTUM YIELD OF PHOTOSYSTEM II1 (LQY1) . These proteins represent evolutionary adaptations to the specific light environments encountered by land plants. In Arabidopsis, HYPERSENSITIVE TO HIGH LIGHT1 (HHL1) interacts with LQY1 to form a complex involved in the repair and reassembly of PSII-LHCII supercomplexes under high light conditions .

How should researchers interpret contradictory fluorescence parameters when studying QB function?

When analyzing fluorescence parameters related to QB function, researchers should consider these principles for resolving apparent contradictions:

  • Distinguish between correlation and causation in parameter relationships

  • Consider the time-dependent nature of parameters (fast vs. slow relaxation components)

  • Recognize that similar fluorescence signatures may result from different molecular mechanisms

  • Analyze parameter relationships across multiple light intensities and genetic backgrounds

For example, research on Arabidopsis mutants revealed an apparently counterintuitive relationship where increases in photoprotective qE coincided with higher rates of photoinhibition (qI). This contradiction was resolved by recognizing that both stemmed from increased pmf, but through different mechanisms - qE through ΔpH and photoinhibition through Δψ . Additionally, researchers should be aware that parameters like 1-qP and 1-qL, which reflect the redox state of the QA electron acceptor, may show different patterns between wild-type and mutant plants under high light conditions .

What statistical approaches best detect subtle functional changes in QB behavior across genetic variants?

To detect subtle functional changes in QB behavior, researchers should employ these statistical approaches:

  • ANOVA with interaction terms to analyze relationships between multiple parameters (as used to assess QA redox state, qI, light intensity, and qE interactions, p=2×10⁻¹⁶)

  • Repeated measures designs to account for time-dependent changes in photosynthetic parameters

  • Mixed models that incorporate both fixed effects (e.g., genotype, light intensity) and random effects (e.g., biological replication)

  • Multivariate analyses to identify patterns across multiple interrelated parameters

When analyzing QB function in mutant lines, researchers successfully used statistical approaches to disentangle the relationships between QA redox state (qL), photoinhibition (qI), and light intensity, identifying both the main effects and significant interactions between these factors .

How can researchers differentiate between QB-associated and alternative photoinhibition mechanisms?

Differentiating between QB-associated and alternative photoinhibition mechanisms requires a systematic experimental approach:

  • Compare photoinhibition patterns in the presence of specific electron transport inhibitors targeting different photosynthetic complexes

  • Use chloroplast translation inhibitors like lincomycin to distinguish between damage and repair limitations

  • Analyze photoinhibition in mutants with alterations in specific components of the photosynthetic apparatus

  • Measure specific markers of different photodamage pathways (e.g., D1 fragmentation patterns, ROS production)

Research on Arabidopsis mutants with altered thylakoid proton conductivity (gH+) revealed that high pmf increased photoinhibition even when PSII repair was blocked with lincomycin, demonstrating a direct effect on photodamage rates rather than repair inhibition . By correlating photoinhibition with calculated recombination rates through the P⁺Pheo⁻ pathway (considering QA redox state and Δψ effects), researchers established that Δψ-mediated changes in PSII electron recombination can explain a large fraction of observed photoinhibition variations across different genetic backgrounds .

What emerging technologies might advance our understanding of QB dynamics in photosystem proteins?

Emerging technologies with potential to revolutionize QB research include:

  • Time-resolved cryo-electron microscopy to capture conformational changes during QB reduction

  • Ultra-fast spectroscopic techniques to measure electron transfer events at picosecond-to-nanosecond timescales

  • Computational approaches integrating quantum mechanics with molecular dynamics to model electron and proton transfer

  • Genetically encoded biosensors for in vivo measurement of localized pmf components

These technologies could enable researchers to directly observe QB reduction dynamics under physiological conditions and better understand how protein structure influences electron transfer efficiency and susceptibility to photoinhibition.

How might climate change factors alter QB function and associated photoinhibition?

Climate change factors may significantly impact QB function through several mechanisms:

  • Elevated temperatures could alter the kinetics of QB reduction and protonation

  • Increased CO2 levels may affect electron transport rates and QB redox state

  • More frequent extreme weather events could exacerbate photoinhibition through combined stress effects

  • Changes in light intensity and quality could affect the balance between photodamage and repair

Research on model organisms like Arabidopsis suggests that photosynthetic mechanisms have evolved specific temperature optima, and climate change may push photosystems beyond these optima. The study of mutants with altered sensitivity to high light, such as the hhl1 mutants, provides insights into how plants might adapt to changing environmental conditions .

What potential applications exist for engineering QB properties to enhance photosynthetic efficiency?

Engineering QB properties presents several promising approaches for enhancing photosynthetic efficiency:

  • Optimizing the redox potential of QB to improve electron transfer efficiency

  • Modifying amino acids that influence proton delivery to QB

  • Engineering photoprotection mechanisms to reduce QB-associated photoinhibition

  • Designing synthetic electron acceptors with improved properties

Research on photoprotective mechanisms like those involving HHL1 and LQY1 proteins in Arabidopsis suggests that enhancing PSII repair and reassembly processes could significantly improve photosynthetic performance under fluctuating light conditions . Similarly, understanding the dual photoprotective strategy involving qE and qT in Chlamydomonas reinhardtii could inform approaches to engineer crops with improved resilience to high light stress .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.