Recombinant Cryptococcus neoformans var. neoformans serotype D 3-ketoacyl-CoA reductase (CNBH0660)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CNBH0660; Very-long-chain 3-oxoacyl-CoA reductase; 3-ketoacyl-CoA reductase; 3-ketoreductase; KAR; Microsomal beta-keto-reductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-361
Protein Length
full length protein
Species
Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) (Filobasidiella neoformans)
Target Names
CNBH0660
Target Protein Sequence
MVADTVHVGQHLAGHPSVHLFGHEIVLDVSIPALILSTVGAAFLLRYTLSIFRLFLELTV LPGKDIKSFQSRKGETWAVVTGCTSGIGLEFARQLAAKKFNIILVGRRQSALTDLSKEIE SKYDVHTKSVTVDVSTPGSARDDALTQLELLAQNLDVGILINNVGASHSMPVAFHETERS EMSRIIETNVTWTYLVTRSILPSMVARSKQKGAPKSLVITIGSLSGRIPSPLLASYSGTK AALATWTKALAEEVKPQGVIVELVQAAFVVSNMSKIRKSSPFVPTPAPFVRSTLNSIGLP RGAQGRPHERTPFWSHAILDYVVGFAGYVSEMAGIKVILGMHKDIRKRALKKAARDEKKA E
Uniprot No.

Target Background

Function

Component of the microsomal membrane-bound fatty acid elongation system responsible for producing 26-carbon very long-chain fatty acids (VLCFAs) from palmitate. It catalyzes the reduction of the 3-ketoacyl-CoA intermediate generated in each cycle of fatty acid elongation. VLCFAs serve as precursors for ceramide and sphingolipids.

Database Links
Protein Families
Short-chain dehydrogenases/reductases (SDR) family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.

Q&A

How does CNBH0660 fit into the metabolic pathways of Cryptococcus neoformans?

CNBH0660 plays a crucial role in fatty acid metabolism in C. neoformans, particularly in the elongation of fatty acids. Its function as a 3-ketoacyl-CoA reductase suggests involvement in the reduction step of the fatty acid synthesis cycle. This enzyme likely functions in coordination with other acetyl-CoA metabolism enzymes like ATP-citrate lyase (ACL1) and acetyl-CoA synthetase (ACS1), which have been shown to be important for C. neoformans infection and virulence .

The enzyme participates in the acetyl-CoA metabolic network, where multiple pathways converge to ensure sufficient acetyl-CoA production for essential cellular processes. Research indicates that C. neoformans utilizes multiple carbon sources to generate acetyl-CoA, particularly during infection, and the expression of related genes is altered in vivo compared to in vitro conditions .

What are the optimal conditions for expressing recombinant CNBH0660 in E. coli?

For successful expression of recombinant CNBH0660 in E. coli, the following methodological approach is recommended:

  • Expression construct design: The full-length gene (encoding amino acids 1-361) should be cloned into an expression vector with an N-terminal His tag for purification purposes.

  • Expression conditions: Optimal expression is typically achieved using BL21(DE3) E. coli strains at 18-25°C after induction with 0.5-1.0 mM IPTG when the culture reaches OD600 of 0.6-0.8.

  • Media and growth conditions: LB media supplemented with appropriate antibiotics (based on the expression vector) is generally suitable. For enhanced protein yield, enriched media like TB (Terrific Broth) may be preferable.

  • Induction time: Protein expression should proceed for 16-20 hours at reduced temperature to maximize soluble protein yield .

What purification strategy provides the highest yield and purity for recombinant CNBH0660?

A multi-step purification strategy is recommended for obtaining high-yield, high-purity recombinant CNBH0660:

  • Initial capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin for the His-tagged protein.

  • Buffer conditions: Optimal lysis and binding buffer typically contains Tris-HCl (50 mM, pH 8.0), NaCl (300 mM), imidazole (10-20 mM), and possibly glycerol (5-10%).

  • Elution strategy: Gradual elution with increasing imidazole concentration (typically 50-300 mM) to separate the target protein from non-specifically bound contaminants.

  • Secondary purification: Size exclusion chromatography (SEC) using a Superdex 200 column to remove aggregates and further improve purity.

  • Final preparation: The purified protein should be concentrated and buffer-exchanged into a storage buffer containing Tris/PBS with 6% trehalose at pH 8.0. For long-term storage, adding 50% glycerol and storing at -20°C/-80°C is recommended .

Expected purity should exceed 90% as determined by SDS-PAGE. The protein can be stored as a lyophilized powder or in solution with appropriate stabilizers .

What assays can be used to measure CNBH0660 enzymatic activity?

Several assay methodologies can be employed to measure the 3-ketoacyl-CoA reductase activity of CNBH0660:

  • Spectrophotometric assay: The most direct method measures the oxidation of NADPH or NADH (depending on cofactor preference) at 340 nm as the reaction proceeds. The assay mix typically contains:

    • Purified CNBH0660 enzyme (1-10 μg)

    • 3-ketoacyl-CoA substrate (50-200 μM)

    • NAD(P)H cofactor (100-200 μM)

    • Buffer (typically Tris-HCl or phosphate buffer, pH 7.0-8.0)

    • Divalent cations (e.g., Mg²⁺, 1-5 mM)

  • Coupled enzyme assay: Similar to methods used for characterizing other reductases in the fatty acid synthesis pathway.

  • HPLC-based product detection: For more precise characterization, the reaction products can be analyzed using HPLC or LC-MS to directly quantify the reduced product formation.

When determining kinetic parameters, substrate concentrations should be varied while maintaining excess concentrations of other components .

How can researchers distinguish CNBH0660 activity from other ketoacyl-CoA reductases in Cryptococcus neoformans?

Distinguishing CNBH0660 activity from other ketoacyl-CoA reductases requires careful experimental design:

  • Specific substrate preference: CNBH0660 may exhibit different chain-length preferences for 3-ketoacyl-CoA substrates compared to other reductases. Testing activity against a range of chain lengths (C4 to C16) can help establish a substrate specificity profile.

  • Inhibitor sensitivity: Various reductase inhibitors may affect CNBH0660 differently than other reductases. Creating an inhibition profile can aid in distinguishing the enzyme's activity.

  • Cofactor preference: Determining whether the enzyme preferentially uses NADH or NADPH can further distinguish it from other reductases.

  • pH and temperature optima: Establishing the optimal pH and temperature ranges for activity can provide additional distinguishing characteristics.

  • Genetic approaches: Creating knockout or knockdown strains specifically targeting CNBH0660 and comparing the resultant phenotypes and metabolic profiles to wild-type strains provides definitive evidence of specific enzyme activity .

Can CNBH0660 serve as a target for antifungal development against Cryptococcus neoformans?

CNBH0660 presents several characteristics that make it a potential antifungal target:

  • Essential metabolic function: As a key enzyme in fatty acid metabolism, inhibition of CNBH0660 could disrupt membrane biosynthesis and energy production in the fungal pathogen.

  • Structural differences from human homologs: While specific structural comparison data for CNBH0660 is not provided in the search results, other C. neoformans enzymes like ADS lyase show structural differences from their human counterparts that could be exploited for selective inhibition .

  • Potential synergy with existing antifungals: Research on related acetyl-CoA metabolism enzymes has shown that disruption of these pathways can increase susceptibility to fluconazole, suggesting that targeting CNBH0660 might enhance the efficacy of existing antifungal therapies .

  • Target validation approach: A comprehensive target validation would involve:

    • Creating knockout strains to confirm essentiality or significant contribution to virulence

    • Structural characterization to identify unique binding pockets

    • High-throughput screening for selective inhibitors

    • In vivo testing of lead compounds in animal models of cryptococcosis

Researchers should consider potential redundancy in metabolic pathways, as C. neoformans has shown adaptability in acetyl-CoA metabolism during infection .

What structural features distinguish CNBH0660 from homologous enzymes in other species?

While the search results don't provide specific structural data for CNBH0660, insights can be drawn from related C. neoformans enzymes and what is known about 3-ketoacyl-CoA reductases:

  • Active site architecture: 3-ketoacyl-CoA reductases typically contain a catalytic triad and specific binding pockets for the acyl chain, CoA moiety, and NAD(P)H cofactor. Slight variations in these regions can affect substrate specificity and catalytic efficiency.

  • Comparative analysis: Related C. neoformans enzymes like ADS lyase show structural similarities to human counterparts but with key differences in the active site cavity. For example, in ADS lyase, a lysine to arginine substitution expands the binding pocket by approximately 2 Å, which could allow for selective targeting .

  • Oligomeric state: The quaternary structure of CNBH0660 may differ from homologs in other species, potentially affecting stability, regulation, and function.

For definitive structural characterization, researchers should consider:

  • X-ray crystallography or cryo-EM studies of purified CNBH0660

  • Homology modeling based on structurally resolved homologs

  • Molecular dynamics simulations to identify functional motions and binding pocket dynamics .

What protein-protein interactions does CNBH0660 participate in within Cryptococcus neoformans?

Understanding the protein interaction network of CNBH0660 requires several experimental approaches:

  • Co-immunoprecipitation: Using anti-CNBH0660 antibodies to pull down the enzyme along with its interaction partners from C. neoformans lysates.

  • Yeast two-hybrid screening: A systematic approach to identify binary protein interactions.

  • Proximity-based labeling: Methods like BioID or APEX can identify proteins in close proximity to CNBH0660 in vivo.

  • Crosslinking mass spectrometry: To capture transient interactions and identify interaction interfaces.

As a metabolic enzyme, CNBH0660 likely interacts with other enzymes in the fatty acid synthesis pathway, forming potential multi-enzyme complexes. Based on studies of related metabolic enzymes, CNBH0660 may also interact with regulatory proteins that coordinate metabolic responses to environmental changes and stress conditions .

Researchers should prioritize investigating interactions with other enzymes involved in acetyl-CoA metabolism, as genetic interaction studies have shown functional relationships between different acetyl-CoA producing pathways in C. neoformans .

What methods are most effective for generating CNBH0660 gene knockouts or mutations in Cryptococcus neoformans?

Generating CNBH0660 gene knockouts or mutations in C. neoformans can be achieved through several approaches:

  • Homologous recombination with fusion PCR constructs: This is the standard method for targeted gene deletion in C. neoformans. It involves:

    • Designing primers to amplify 5' and 3' flanking regions (approximately 1 kb each) of the CNBH0660 gene

    • Amplifying a selectable marker (typically an antibiotic resistance cassette)

    • Using fusion PCR to join these three fragments

    • Transforming C. neoformans with the linear construct

    While homologous recombination efficiency is relatively low in C. neoformans (1-4% compared to nearly 100% in S. cerevisiae), linear constructs with sufficient homologous flanking sequences can create stable integrants reproducibly .

  • CRISPR-Cas9 system: Recent adaptations of CRISPR-Cas9 for C. neoformans have improved targeting efficiency.

  • Conditional expression systems: For essential genes, using promoters like the copper-regulated CTR4 promoter allows for conditional expression and depletion studies .

  • Site-directed mutagenesis: For studying specific protein domains or catalytic residues, rather than complete gene deletion.

Verification of successful genetic manipulation should include PCR confirmation, Southern blotting, and phenotypic analysis appropriate to the expected function of CNBH0660 .

How does CNBH0660 expression change during different stages of Cryptococcus neoformans infection?

While the search results don't provide specific data on CNBH0660 expression patterns, insights can be drawn from studies of related metabolic enzymes in C. neoformans:

  • In vivo vs. in vitro expression: Research has demonstrated that many genes related to central carbon metabolism, including those involved in acetyl-CoA production, show altered expression during infection compared to laboratory culture conditions. Related enzymes like ACS1 and KBC1 show increased expression in vivo compared to in vitro conditions .

  • Expression during macrophage interaction: Deletion of acetyl-CoA related genes results in reduced fitness during replication in macrophages, suggesting that these metabolic pathways, potentially including CNBH0660, are important during this phase of infection .

  • Tissue-specific expression patterns: Different host environments (lung, cerebrospinal fluid, brain) may induce different expression patterns of metabolic enzymes.

To specifically analyze CNBH0660 expression:

  • qRT-PCR analysis from infected tissues at different timepoints

  • RNA-seq of C. neoformans recovered from various infection sites

  • Reporter gene constructs (e.g., CNBH0660 promoter driving GFP expression)

  • Protein level analysis using specific antibodies against CNBH0660

How can recombinant CNBH0660 be used in screening for novel antifungal compounds?

Recombinant CNBH0660 provides a valuable tool for antifungal drug discovery through several approaches:

  • Biochemical activity assays: High-throughput screening can be performed using purified CNBH0660 in spectrophotometric assays measuring NAD(P)H oxidation in the presence of substrate and potential inhibitors. This approach allows for:

    • Rapid screening of large compound libraries

    • Determination of IC50 values for hit compounds

    • Structure-activity relationship studies

  • Thermal shift assays: Measuring changes in protein thermal stability upon compound binding can identify ligands without requiring enzymatic activity measurement.

  • Structure-based virtual screening: If the protein structure is determined or a high-quality homology model is available, in silico screening can identify compounds likely to bind to catalytic or allosteric sites.

  • Fragment-based drug discovery: Using biophysical methods like NMR or SPR to identify low molecular weight fragments that bind to CNBH0660 and can be elaborated into more potent inhibitors.

  • Phenotypic validation: Compounds identified in primary screens should be validated using C. neoformans strains with modified CNBH0660 expression (overexpression or conditional knockdowns) to confirm on-target activity .

What is the potential for using CNBH0660 in vaccine development against cryptococcosis?

While CNBH0660 itself has not been specifically evaluated as a vaccine candidate in the provided search results, insights can be drawn from research on other C. neoformans proteins:

What are common challenges in working with recombinant CNBH0660 and how can they be addressed?

Researchers working with recombinant CNBH0660 may encounter several technical challenges:

  • Protein solubility issues:

    • Challenge: Recombinant expression may result in inclusion bodies.

    • Solution: Optimize expression conditions by lowering induction temperature (16-18°C), reducing IPTG concentration, or using solubility-enhancing fusion tags (SUMO, MBP, or TrxA).

  • Protein stability during purification:

    • Challenge: Protein aggregation or degradation during purification.

    • Solution: Include protease inhibitors in lysis buffers, optimize buffer conditions (pH, salt concentration, glycerol), and consider adding stabilizing agents like trehalose (6%) as used in commercial preparations .

  • Activity loss after purification:

    • Challenge: Purified enzyme shows reduced or no activity.

    • Solution: Ensure careful buffer selection for storage, avoid repeated freeze-thaw cycles, store working aliquots at 4°C for up to one week, and consider adding glycerol (up to 50%) for long-term storage at -20°C/-80°C .

  • Batch-to-batch variability:

    • Challenge: Inconsistent enzyme activity between preparations.

    • Solution: Standardize expression and purification protocols, implement rigorous quality control testing, and normalize activity using standard substrates.

  • Reconstitution of lyophilized protein:

    • Challenge: Improper reconstitution leading to reduced activity.

    • Solution: Briefly centrifuge the vial prior to opening, reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL, and consider adding glycerol (5-50% final concentration) for aliquoting and long-term storage .

How can researchers optimize experimental conditions when studying CNBH0660 interactions with other metabolic enzymes?

Optimizing experimental conditions for studying CNBH0660 interactions with other metabolic enzymes requires careful consideration of several factors:

  • In vitro reconstruction of metabolic pathways:

    • Use purified recombinant enzymes in defined ratios

    • Ensure proper buffer conditions that support activity of all enzymes in the pathway

    • Include appropriate cofactors for all enzymatic steps

    • Consider immobilization strategies to mimic the spatial organization found in vivo

  • Detection of transient protein-protein interactions:

    • Use chemical crosslinking with MS analysis to capture and identify transient interactions

    • Implement FRET-based assays with fluorescently labeled proteins to detect interactions in real-time

    • Consider biolayer interferometry or surface plasmon resonance for quantitative binding kinetics

  • Reconstitution in artificial membrane systems:

    • If CNBH0660 associates with membranes, consider using liposomes or nanodiscs to provide a more native-like environment

    • Optimize lipid composition to match the fungal membrane environment

  • Genetic interaction studies:

    • Design experiments similar to those used for ACS1, ACL1, and KBC1, where double mutants revealed synthetic genetic interactions

    • Consider using conditional expression systems for essential genes

    • Analyze phenotypes under various growth conditions to identify condition-specific interactions

  • Metabolomics approaches:

    • Track metabolite flux through pathways using stable isotope labeling

    • Compare metabolic profiles between wild-type and CNBH0660-modified strains

    • Integrate metabolomics data with transcriptomics to identify coordinated regulation of metabolic pathways

The genetic interaction approach used to study ACL1, ACS1, and KBC1 provides a valuable model for investigating CNBH0660's role in metabolic networks. Similar methodologies could reveal whether CNBH0660 has synthetic phenotypes with other enzymes in fatty acid metabolism pathways .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.