Recombinant Cryptococcus neoformans var. neoformans serotype D 3-ketoacyl-CoA reductase (CNI00690)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for customers.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Please specify your desired tag type for preferential development.
Synonyms
CNI00690; Very-long-chain 3-oxoacyl-CoA reductase; 3-ketoacyl-CoA reductase; 3-ketoreductase; KAR; Microsomal beta-keto-reductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-361
Protein Length
full length protein
Species
Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) (Filobasidiella neoformans)
Target Names
CNI00690
Target Protein Sequence
MVADTVHVGQHLAGHPSVHLFGHEIVLDVSIPALILSTVGAAFLLRYTLSIFRLFLELTV LPGKDIKSFQSRKGETWAVVTGCTSGIGLEFARQLAAKKFNIILVGRRQSALTDLSKEIE SKYDVHTKSVTVDVSTPGSARDDALTQLELLAQNLDVGILINNVGASHSMPVAFHETERS EMSRIIETNVTWTYLVTRSILPSMVARSKQKGAPKSLVITIGSLSGRIPSPLLASYSGTK AALATWTKALAEEVKPQGVIVELVQAAFVVSNMSKIRKSSPFVPTPAPFVRSTLNSIGLP RGAQGRPHERTPFWSHAILDYVVGFAGYVSEMAGIKVILGMHKDIRKRALKKAARDEKKA E
Uniprot No.

Target Background

Function

Component of the microsomal membrane-bound fatty acid elongation system responsible for producing 26-carbon very long-chain fatty acids (VLCFAs) from palmitate. It catalyzes the reduction of the 3-ketoacyl-CoA intermediate in each cycle of fatty acid elongation. VLCFAs serve as precursors for ceramide and sphingolipids.

Database Links

KEGG: cne:CNI00690

STRING: 214684.XP_572756.1

UniGene: Fne.6953

Protein Families
Short-chain dehydrogenases/reductases (SDR) family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.

Q&A

What is Recombinant Cryptococcus neoformans var. neoformans serotype D 3-ketoacyl-CoA reductase and its function?

3-ketoacyl-CoA reductase (CNI00690) is an enzyme involved in fatty acid metabolism in Cryptococcus neoformans. The recombinant form typically refers to the full-length protein (361 amino acids) expressed in a heterologous system such as E. coli, often with an affinity tag (such as His-tag) for purification purposes. The enzyme is also known as Very-long-chain 3-oxoacyl-CoA reductase, 3-ketoreductase, KAR, or Microsomal beta-keto-reductase, with UniProt ID P0CR34 .

The protein functions in fatty acid elongation pathways, catalyzing the reduction of 3-ketoacyl-CoA to 3-hydroxyacyl-CoA using NADPH as a cofactor. This reaction is part of the fatty acid synthase system that is crucial for membrane lipid biosynthesis in the fungus.

How should recombinant CNI00690 protein be stored and handled for optimal stability?

The recombinant CNI00690 protein is typically supplied as a lyophilized powder. For optimal stability:

  • Store the lyophilized protein at -20°C/-80°C upon receipt

  • Aliquot the reconstituted protein to avoid repeated freeze-thaw cycles

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% for long-term storage at -20°C/-80°C (50% glycerol is recommended as default)

  • Working aliquots can be stored at 4°C for up to one week

  • Brief centrifugation of the vial prior to opening is recommended to bring contents to the bottom

The protein is typically stored in Tris/PBS-based buffer with 6% Trehalose at pH 8.0, which helps maintain stability during storage .

How does CNI00690 compare with related enzymes in fungal metabolic pathways?

CNI00690 functions within a complex network of metabolic enzymes in Cryptococcus neoformans. In the context of acetyl-CoA metabolism, several key enzymes play important roles:

  • ATP-citrate lyase (ACL1): Converts citrate to succinate and acetyl-CoA

  • Acetyl-CoA synthetase (ACS1): Converts acetate to acetyl-CoA

  • 2-keto butyryl CoA synthetase 1 (KBC1): Previously misannotated as ACS2, converts acetoacetate to acetoacetyl-CoA

While 3-ketoacyl-CoA reductase (CNI00690) functions in fatty acid metabolism, its activity depends on acetyl-CoA availability. Research has shown that ACL1 and ACS1 represent a synthetic lethal pair of genes, meaning deletion of both is lethal to the fungus, indicating that acetyl-CoA production is essential for survival .

The importance of these interconnected pathways is highlighted by the observation that deletion of any one of these enzymes reduces fitness within macrophages, suggesting their critical role during infection .

What experimental models are appropriate for studying CNI00690 function in vivo?

Based on established cryptococcal research models, the following experimental systems are appropriate for studying CNI00690 function in vivo:

Mouse Models:

  • Immunocompetent mice (BALB/c, C57BL/6): Useful for studying CNI00690's role in normal host response

  • Immunocompromised mice (SCID): Appropriate for studying invasive infection scenarios

  • Glucocorticoid-immunosuppressed mice: Relevant for studying infection in pharmacologically immunosuppressed hosts

Infection Routes:

  • Intravenous (i.v.) inoculation: Allows for direct study of disseminated infection

  • Intranasal/intratracheal: Models pulmonary acquisition, the natural infection route

  • Intracranial: Specifically targets CNS involvement

Inoculum Considerations:

  • Mortality is inoculum size-dependent in each model system

  • Lower inocula (≤10^5 CFU) may be more appropriate for long-term studies

  • Higher inocula (10^6-10^7 CFU) produce more rapid disease progression

For mutant studies specifically assessing CNI00690 function, comparative analyses using wildtype, single mutant, and complemented strains are essential for attributing phenotypes to the specific gene.

What techniques can be used to assess the enzymatic activity of recombinant CNI00690?

Several established techniques can be used to assess the enzymatic activity of recombinant CNI00690:

Spectrophotometric Assays:

  • NADPH-consumption assay: Monitoring the decrease in absorbance at 340nm as NADPH is oxidized during the reduction of 3-ketoacyl-CoA to 3-hydroxyacyl-CoA

  • Coupled enzyme assays: Similar to those used for acetoacetyl-CoA synthetase, where activity can be measured via continuous detection of pyrophosphate release

Kinetic Analysis:

  • Determination of Km values for substrates (3-ketoacyl-CoA and NADPH)

  • Evaluation of potential substrate inhibition effects

  • pH and temperature optima determination

Validation Controls:

  • Heat-inactivated enzyme as negative control

  • Known 3-ketoacyl-CoA reductase from related organisms as positive control

  • Substrate-omission controls to confirm specificity

Similar to methodology used for other related enzymes, kinetic parameters can be determined by varying substrate concentrations and fitting the data to appropriate models such as Michaelis-Menten or models accounting for substrate inhibition .

How does CNI00690 contribute to the virulence of C. neoformans?

CNI00690, as a fatty acid metabolism enzyme, likely contributes to C. neoformans virulence through several mechanisms:

  • Membrane Integrity: By participating in fatty acid elongation, CNI00690 contributes to the synthesis of complex lipids necessary for cellular membrane integrity, which is crucial for survival in the host environment.

  • Adaptation to Host Environments: Expression of metabolic enzymes, including those involved in acetyl-CoA metabolism, is increased in vivo relative to in vitro conditions, suggesting their importance during infection .

  • Nutrient Acquisition: In nutrient-limited environments like the phagolysosome, efficient fatty acid metabolism may provide an alternative energy source.

  • Stress Resistance: Proper membrane composition, influenced by fatty acid metabolism, contributes to resistance against host-imposed stresses, including oxidative and nitrosative stress.

While direct studies on CNI00690 knockout may be limited, research on related enzymes suggests that disruption of fatty acid metabolism pathways reduces fitness within macrophages and during infection .

How do environmental conditions affect CNI00690 expression and activity?

The expression and activity of CNI00690 and related metabolic enzymes are significantly influenced by environmental conditions:

In Vivo vs. In Vitro Expression:

  • Related enzymes like ACS1 and KBC1 show increased expression in vivo relative to in vitro conditions, suggesting upregulation during infection

  • This pattern likely extends to other metabolic enzymes including CNI00690

Nutrient Availability:

  • Carbon source availability modulates the expression of acetyl-CoA metabolism enzymes

  • Lipids appear to coordinately regulate the expression of these enzymes

Host Microenvironments:

  • The low-nutrient environment of the phagolysosome appears to make these metabolic enzymes particularly important, as deletion of related enzymes reduces fitness within macrophages

  • CNS infection creates unique metabolic demands that may influence CNI00690 expression

Research with other C. neoformans metabolic enzymes suggests that the organism adapts by utilizing multiple carbon sources to generate the required amount of acetyl-CoA for efficient replication during infection .

What is the optimal approach for expressing and purifying recombinant CNI00690?

Based on established protocols for similar proteins, the following approach is recommended for expressing and purifying recombinant CNI00690:

Expression System:

  • E. coli is the established system for CNI00690 expression

  • BL21(DE3) or similar strains are typically used for high-level expression

  • pET vector systems with T7 promoter control provide good expression levels

Expression Conditions:

  • Culture growth at 37°C to mid-log phase (OD600 ~0.6-0.8)

  • Temperature reduction to 16-25°C prior to induction

  • IPTG induction at 0.1-1.0 mM for 16-20 hours

  • Harvesting by centrifugation and storage of pellets at -80°C

Purification Strategy:

  • Cell lysis using sonication or pressure-based methods in appropriate buffer (typically Tris-HCl pH 8.0, 300mM NaCl, 10mM imidazole)

  • Immobilized Metal Affinity Chromatography (IMAC) using Ni-NTA resin for His-tagged protein

  • Optional secondary purification using size exclusion chromatography

  • Buffer exchange and concentration

Quality Control:

  • SDS-PAGE to confirm purity (greater than 90%)

  • Western blotting to confirm identity

  • Activity assays to confirm functionality

This approach has been successfully used for similar proteins from C. neoformans including other metabolic enzymes .

What controls should be included in experiments utilizing recombinant CNI00690?

When designing experiments with recombinant CNI00690, the following controls should be included:

For Enzymatic Assays:

  • No-enzyme control: Complete reaction mixture without CNI00690

  • No-substrate control: Reaction lacking each individual substrate (separately)

  • Heat-inactivated enzyme control: CNI00690 boiled for 10 minutes

  • Known 3-ketoacyl-CoA reductase control: If available, from model organisms

  • NADPH-only control: To account for non-enzymatic NADPH oxidation

For Binding Studies:

  • Non-specific binding control: Unrelated His-tagged protein

  • Tag-only control: Peptide containing only the His-tag

  • Competitive binding control: Known ligands or substrates

For Cellular Studies:

  • Vehicle control: Buffer composition matching the CNI00690 preparation

  • Endotoxin testing: Ensuring LPS contamination isn't affecting results

  • Concentration controls: Multiple concentrations to establish dose-response

For In Vivo Studies:

  • Wild-type strain: Without genetic modifications

  • Genetic deletion mutant: CNI00690 knockout strain

  • Complemented strain: Mutant with restored CNI00690 expression

  • Related enzyme mutants: For comparative analysis

These controls help ensure experimental rigor and allow proper interpretation of results when studying CNI00690 function.

What genetic interaction studies have revealed about CNI00690 and related enzymes?

Genetic interaction studies with related enzymes in C. neoformans have provided valuable insights that may extend to CNI00690:

Synthetic Lethality:

  • ATP-citrate lyase (ACL1) and acetyl-CoA synthetase (ACS1) represent a synthetic lethal pair of genes, indicating that at least one pathway for acetyl-CoA generation is essential for viability

Double Mutant Phenotypes:

Macrophage Fitness:

  • Deletion of any one of the acetyl-CoA related enzymes reduces fitness within macrophages

  • This suggests the low-nutrient environment of the phagolysosome makes these metabolic pathways particularly important

Antifungal Susceptibility:

  • The acs1Δ mutant shows hypersusceptibility to fluconazole in vivo despite minimal in vitro phenotypes

  • This indicates that metabolic adaptations become particularly important during infection

Similar studies focusing specifically on CNI00690 would likely reveal its interactions with these and other metabolic pathways.

How can knockout or knockdown studies of CNI00690 be designed to assess its function?

Knockout Strategy:

  • Construct Design:

    • Design a deletion cassette containing a selectable marker (e.g., NAT or NEO) flanked by sequences homologous to regions upstream and downstream of CNI00690

    • For precise editing, CRISPR-Cas9 system can be employed with guide RNAs targeting CNI00690

  • Transformation Methods:

    • Biolistic transformation is the established method for C. neoformans

    • Electroporation can also be used but with lower efficiency

  • Selection and Verification:

    • Select transformants on appropriate antibiotic media

    • Verify deletion by PCR, Southern blotting, and RT-PCR/qPCR

    • Confirm absence of protein by Western blotting if antibodies are available

  • Complementation:

    • Generate a complemented strain by reintroducing the wild-type gene under its native promoter

    • Use a different selectable marker for complementation

Knockdown Strategy:

  • RNA Interference:

    • Design hairpin RNAs targeting CNI00690 mRNA

    • Use inducible or constitutive promoters to control expression

  • Conditional Systems:

    • Employ a tetracycline-repressible promoter system

    • Replace the native promoter with a regulatable promoter (e.g., GAL7)

Phenotypic Assessment:

  • In Vitro Characterization:

    • Growth in different media and carbon sources

    • Stress resistance (temperature, oxidative, cell wall stressors)

    • Lipid profiling and fatty acid composition analysis

  • In Vivo Assessment:

    • Infection models as described in section 2.2

    • Fungal burden determination in various organs

    • Host survival analysis

    • Competitive infection assays with wild-type strain

This approach follows established methodologies for genetic analysis in C. neoformans, similar to those used for related metabolic enzymes .

What are the implications of CNI00690 for antifungal drug development?

CNI00690 and related metabolic enzymes represent promising targets for antifungal drug development based on several key considerations:

Target Validation:

  • Essential metabolic pathways often make good drug targets

  • Genetic studies with related enzymes (ACL1, ACS1) demonstrate their importance for virulence

  • Enhanced susceptibility to existing antifungals when these pathways are disrupted suggests potential for combination therapy

Structural Considerations:

  • As an enzyme with defined catalytic activity, rational inhibitor design is feasible

  • The availability of recombinant protein enables high-throughput screening approaches

  • The full-length sequence available (361aa) allows for structural modeling studies

Selective Toxicity:

  • Differences between fungal and human orthologs may provide selectivity

  • Targeting fungal-specific aspects of the enzyme could minimize host toxicity

Resistance Considerations:

  • Metabolic enzymes may have a higher barrier to resistance development

  • Understanding genetic interactions can predict potential resistance mechanisms

  • The observation that acs1Δ mutants show hypersusceptibility to fluconazole in vivo suggests that inhibitors of these pathways might synergize with existing antifungals

Drug Development Approach:

  • In vitro enzyme assays for initial screening

  • Cell-based secondary screens to confirm cell permeability and on-target effects

  • Validation in animal models of cryptococcosis

  • Structure-activity relationship studies to optimize lead compounds

This approach builds on insights from studies of acetyl-CoA metabolism enzymes in C. neoformans, which have demonstrated their importance during infection and potential as antifungal targets .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.