Recombinant Cryptococcus neoformans var. neoformans serotype D 3-ketodihydrosphingosine reductase TSC10 (TSC10)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is defined during production. If a specific tag type is required, please inform us, and we will prioritize its implementation.
Synonyms
TSC10; CNG00270; 3-ketodihydrosphingosine reductase TSC10; 3-dehydrosphinganine reductase; KDS reductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-335
Protein Length
full length protein
Species
Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) (Filobasidiella neoformans)
Target Names
TSC10
Target Protein Sequence
MPTPLALLLSAILIIGTYFAMPFWPFRKSNYDPRGKHCYITGGSSGLGKALAERLVKQGA HVTIVGRDSKKAEGVVEELKAIAAPGQIIQCIAADLTSPIASTNAIHAACKPHADQAPDY VYLCAGFSRPKLFVETTKQELKDGLDGVYWVSAYTAHEACQMMSKQRRTGKIIFVASFLS YVSFAGYSSYSPAKYALRGLSDALRSEMLLHNIDIHIFLPCGISGPGFDAENRTKPAVTK KIEEGDTPITPDVCAAALESGLKKGYYQITDNLVTEPIRLRSNGGVPTNNFLLDTLWLIV SSVGVPIWRMTADSAVRSFRAKVEKELEAKGYYVS
Uniprot No.

Target Background

Function
Catalyzes the reduction of 3-ketodihydrosphingosine (KDS) to dihydrosphingosine (DHS).
Database Links

KEGG: cne:CNG00270

STRING: 214684.XP_571760.1

UniGene: Fne.182

Protein Families
Short-chain dehydrogenases/reductases (SDR) family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.

Q&A

What is the biochemical function of TSC10 in Cryptococcus neoformans?

TSC10 in Cryptococcus neoformans functions as a 3-ketodihydrosphingosine reductase that catalyzes the second step in the de novo sphingolipid biosynthesis pathway. Specifically, it reduces 3-ketodihydrosphingosine to produce dihydrosphingosine (sphinganine) . This enzymatic reaction is critical for the production of sphingolipids, which are essential components of fungal cell membranes and play roles in cell signaling and protein trafficking. The enzyme belongs to the short-chain dehydrogenase/reductase (SDR) superfamily and utilizes NADPH as a cofactor for the reduction reaction . Given that sphingolipids are essential for cell viability, TSC10 represents a potential target for antifungal development, particularly important since C. neoformans is a significant opportunistic pathogen causing cryptococcal meningitis in immunocompromised individuals .

How does TSC10 structurally compare to mammalian KDSR (3-ketodihydrosphingosine reductase)?

  • TSC10 exists predominantly as a dimer in solution, with the interface mediated by helices α4 and α5

  • The differences in interface residues could potentially be exploited for the development of selective inhibitors

  • Such inhibitors might disrupt dimerization in fungal TSC10 without affecting mammalian KDSR

This structural divergence provides a rational basis for the design of antifungal compounds with reduced host toxicity.

What experimental assays can measure TSC10 enzymatic activity in vitro?

Several methodological approaches can be employed to measure TSC10 activity in vitro:

  • NADPH-dependent spectrophotometric assay: This direct continuous assay monitors the decrease in absorbance at 340 nm as NADPH is consumed during the reaction . The reaction mixture typically contains:

    • Purified recombinant TSC10

    • 3-ketodihydrosphingosine substrate (solubilized appropriately)

    • NADPH (usually 100-200 μM)

    • Buffer system (often HEPES or phosphate at pH 7.0-7.5)

    • Salt (typically 100-150 mM NaCl)

  • Fluorometric assay: Measures the decrease in NADPH fluorescence (excitation 340 nm, emission 460 nm) for enhanced sensitivity.

  • HPLC/LC-MS-based assay: Directly quantifies the production of dihydrosphingosine after the reaction is quenched and lipids are extracted. This approach offers specificity for confirming product identity but is discontinuous.

  • Radiometric assay: Using radiolabeled substrate (³H or ¹⁴C labeled 3-ketodihydrosphingosine) and measuring conversion to product after separation.

For enzyme kinetic analysis, varying substrate concentrations while maintaining constant enzyme and NADPH levels allows determination of KM and Vmax values through nonlinear regression fitting to the Michaelis-Menten equation.

How do the disordered regions in the crystal structure of TSC10 impact our understanding of its function?

The crystal structure of Cryptococcus neoformans TSC10 revealed several disordered regions that provide important insights into the enzyme's function . These include:

  • The segment connecting the serine and tyrosine residues of the catalytic triad (the "substrate loop")

  • The C-terminal region that often participates in homo-tetramerization in other SDRs

  • Incomplete ordering of the NADPH cofactor

These structural features indicate significant flexibility in the catalytic site of cnTSC10 . The functional implications of these disordered regions include:

  • Substrate binding mechanism: The disordered substrate loop likely undergoes conformational changes upon substrate binding, adopting an ordered structure to properly position the catalytic residues. This induced-fit mechanism is common in enzymes and may contribute to substrate specificity.

  • Regulatory potential: The flexibility might represent a regulatory mechanism where binding of substrates, cofactors, or potential regulatory molecules induces conformational changes that modulate activity.

  • Implications for inhibitor design: The conformational flexibility presents both challenges and opportunities for structure-based drug design. While a rigid binding site would be easier to target, the flexibility might allow for the design of inhibitors that stabilize specific inactive conformations.

  • Oligomerization dynamics: The disordered C-terminal region suggests that the equilibrium between dimeric and tetrameric forms observed in solution might be functionally relevant .

Methodologically, techniques like hydrogen-deuterium exchange mass spectrometry (HDX-MS) or molecular dynamics simulations could further characterize these flexible regions and their roles in catalysis.

What approaches could be used to target the non-conserved residues at the TSC10 dimer interface for selective antifungal development?

The non-conserved residues at the dimer interface between fungal TSC10 and mammalian KDSR present a promising opportunity for selective antifungal development . Several strategic approaches could be employed:

  • Structure-based virtual screening:

    • Define a pharmacophore model based on the dimer interface structural features

    • Screen compound libraries for molecules that could specifically interact with the non-conserved residues

    • Prioritize compounds predicted to disrupt dimerization without affecting the mammalian counterpart

  • Fragment-based drug discovery:

    • Screen fragment libraries using techniques like thermal shift assays or NMR

    • Identify fragments that bind weakly to specific regions of the dimer interface

    • Grow, merge, or link fragments to develop more potent inhibitors

  • Peptide-based inhibitors:

    • Design peptides that mimic portions of the dimer interface

    • Optimize using techniques like alanine scanning and non-natural amino acid incorporation

    • Convert promising peptides to peptidomimetics for improved pharmacological properties

  • Experimental validation workflow:

    MethodPurposeExpected Outcome
    In vitro dimerization assayConfirm disruption of dimerizationShift from dimer to monomer
    Enzyme activity assayVerify functional consequenceDecreased catalytic activity
    Thermal stability assayAssess impact on protein stabilityAltered melting temperature
    Crystallography/Cryo-EMDetermine binding modeStructural confirmation of interaction
    Cell-based assaysEvaluate antifungal activityGrowth inhibition of C. neoformans
    Mammalian cell assaysConfirm selectivityMinimal toxicity to human cells

The critical advantage of this approach is that targeting protein-protein interactions at the dimer interface offers potential for high selectivity, as these interfaces typically involve larger surface areas with unique features compared to the more conserved active sites .

How does the NADPH cofactor binding mechanism influence TSC10 catalytic activity?

The binding of NADPH to TSC10 is essential for its catalytic function in reducing 3-ketodihydrosphingosine to dihydrosphingosine. The crystal structure of cnTSC10 in complex with NADPH provides important insights into this mechanism . Key aspects include:

  • Binding site architecture: TSC10 adopts a Rossmann fold typical of SDR family enzymes, which creates a specific binding pocket for the NADPH cofactor. The nicotinamide ring of NADPH is positioned to deliver a hydride ion to the ketone group of the substrate.

  • Conformational dynamics: Interestingly, the NADPH cofactor is not fully ordered in the crystal structure, suggesting significant flexibility in the binding site . This observation indicates that:

    • Cofactor binding likely induces conformational changes in the enzyme

    • The enzyme may adopt different conformational states during the catalytic cycle

    • The flexibility might enable efficient binding and release of cofactor and substrate

  • Catalytic mechanism: In the SDR enzyme family, NADPH participates in a proton relay system involving a conserved catalytic triad (typically Ser-Tyr-Lys):

    • The 4-pro-S hydrogen from NADPH's nicotinamide ring is transferred as a hydride to the substrate

    • The tyrosine residue of the catalytic triad functions as a proton donor

    • The lysine residue lowers the pKa of the tyrosine and helps position the nicotinamide ring

    • The serine stabilizes the substrate and helps orient it for hydride transfer

  • Implications for inhibitor design: Understanding the NADPH binding mechanism opens several strategies for inhibitor development:

    • Competitive inhibitors that mimic NADPH structure

    • Mixed inhibitors that bind at allosteric sites and alter NADPH binding affinity

    • Transition state analogs that capture the enzyme in an intermediate conformation

Methodologically, techniques such as isothermal titration calorimetry or surface plasmon resonance could be used to further characterize the thermodynamics and kinetics of NADPH binding to TSC10.

What are the optimal conditions for expressing and purifying recombinant TSC10 from Cryptococcus neoformans?

Based on the successful crystallization of cnTSC10 and general approaches for recombinant protein production, the following optimized protocol can be employed:

  • Expression system selection:

    • E. coli BL21(DE3) or Rosetta strains are recommended for heterologous expression

    • For improved folding, consider eukaryotic systems like Pichia pastoris

    • Expression of the catalytic domain only (as used for crystallization) may improve solubility

  • Vector design considerations:

    • Include an N-terminal or C-terminal His6-tag for purification

    • Consider a cleavable tag with a protease recognition site

    • Optimize codon usage for the expression host

  • Expression conditions optimization:

    • Temperature: Lower temperatures (16-18°C) often improve solubility

    • Induction: For IPTG-inducible systems, use 0.1-0.5 mM IPTG

    • Media: Rich media (TB or 2×YT) typically yields higher protein levels

    • Consider adding NADPH or precursors to stabilize the protein during expression

  • Purification strategy:

    • Initial capture: Ni-NTA affinity chromatography for His-tagged protein

    • Intermediate purification: Ion exchange chromatography

    • Polishing: Size exclusion chromatography, which also provides information on oligomeric state

    • Buffer optimization: Include glycerol (5-10%) and reducing agent (1-5 mM DTT or β-mercaptoethanol)

    • Consider including NADPH in purification buffers to stabilize the protein

  • Quality control:

    • SDS-PAGE and Western blotting to confirm identity and purity

    • Dynamic light scattering to assess homogeneity

    • Thermal shift assay to optimize buffer conditions

    • Activity assay to confirm functionality

  • Special considerations:

    • Since cnTSC10 exists predominantly as a dimer in solution with a minor portion forming tetramers , size exclusion chromatography should be carefully analyzed

    • The flexible regions identified in the crystal structure suggest that stabilizing agents or ligands (like NADPH) may improve protein stability

This systematic approach should yield pure, active recombinant cnTSC10 suitable for biochemical, biophysical, and structural studies.

How can crystallization of TSC10 be optimized for structure-based inhibitor design?

Successful crystallization of TSC10 is critical for structure-based inhibitor design. Based on the reported crystal structure of cnTSC10 and general crystallization principles, the following methodological approach is recommended:

  • Construct optimization:

    • Focus on the catalytic domain as successfully crystallized previously

    • Consider surface entropy reduction mutations to promote crystal contacts

    • Design constructs with different N- or C-terminal boundaries to address flexible regions

  • Protein sample preparation:

    • Ensure high purity (>95% by SDS-PAGE, single peak by size exclusion chromatography)

    • Verify monodispersity using dynamic light scattering

    • Concentrate to 5-20 mg/ml (test multiple concentrations)

    • Include NADPH cofactor during purification and crystallization to stabilize the protein

  • Crystallization screening:

    • Primary approach: Vapor diffusion (hanging drop and sitting drop)

    • Test commercial sparse matrix screens (Hampton Research, Molecular Dimensions)

    • Optimize promising conditions by varying:

      • pH (±0.5 units around initial hit)

      • Precipitant concentration (±2-5%)

      • Protein:reservoir ratio in drops

      • Temperature (4°C, 16°C, 20°C)

  • Strategies for co-crystallization with inhibitors:

    • Pre-incubate protein with inhibitor (typically 2-10× molar excess)

    • For hydrophobic inhibitors, keep final DMSO concentration <5%

    • If co-crystallization fails, try soaking inhibitors into apo-crystals

    • Consider using stabile substrate analogs to capture enzyme-substrate complexes

  • Optimization for difficult cases:

    • Microseeding to improve crystal quality

    • Additive screening to identify stabilizing compounds

    • Crystallization chaperones (e.g., antibody fragments)

    • Lipidic cubic phase for membrane-associated protein domains

  • Data collection considerations:

    • Cryoprotection optimization to minimize ice formation

    • Initial diffraction testing at home source before synchrotron data collection

    • Collection of multiple datasets from different crystals to ensure reproducibility

  • Challenges specific to TSC10:

    • The disordered regions identified in the crystal structure may impact crystallization

    • The conformational flexibility of the catalytic site might require strategies to stabilize specific conformations

This systematic approach should yield high-quality crystals suitable for structure determination of TSC10 alone or in complex with potential inhibitors.

What methodologies can be used to validate potential TSC10 inhibitors identified through computational screening?

A comprehensive validation pipeline for potential TSC10 inhibitors should include biochemical, biophysical, and cellular approaches:

  • Primary biochemical validation:

    • Enzyme inhibition assays:

      • NADPH consumption assay (spectrophotometric or fluorometric)

      • IC50 determination through dose-response curves

      • Determination of inhibition mechanism (competitive, uncompetitive, non-competitive)

      • Ki value determination through appropriate kinetic analysis

  • Biophysical binding confirmation:

    • Thermal shift assays (differential scanning fluorimetry):

      • Measures changes in protein melting temperature upon inhibitor binding

      • Fast method for initial confirmation of binding

    • Isothermal titration calorimetry (ITC):

      • Provides binding affinity (Kd), stoichiometry, and thermodynamic parameters

      • Gold standard for confirming direct binding

    • Surface plasmon resonance (SPR) or bio-layer interferometry (BLI):

      • Measures binding kinetics (kon and koff)

      • Can identify fast or slow binding inhibitors

  • Structural validation:

    • X-ray crystallography:

      • Co-crystallization with inhibitors or soaking into apo-crystals

      • Provides definitive binding mode and protein-inhibitor interactions

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

      • Alternative approach when crystallography is challenging

      • Identifies regions of the protein affected by inhibitor binding

  • Selectivity profiling:

    • Counterscreening against human KDSR:

      • Critical for establishing fungal selectivity

      • Same assays as used for TSC10 but with recombinant human enzyme

    • Broader selectivity panel:

      • Testing against other SDR family members

      • General cytotoxicity screening

  • Cellular validation:

    • Antifungal activity determination:

      • Minimum inhibitory concentration (MIC) against C. neoformans

      • Time-kill kinetics to determine fungicidal vs. fungistatic activity

    • Target engagement in cells:

      • Lipidomics to confirm disruption of sphingolipid pathway

      • Cellular thermal shift assay (CETSA) to confirm target binding in cells

  • Mechanism confirmation:

    • Resistant mutant generation and characterization:

      • Sequencing to identify mutations in TSC10

      • Testing mutant enzymes against inhibitors to confirm resistance mechanism

    • Genetic validation:

      • TSC10 overexpression to confirm target (should increase inhibitor MIC)

      • Heterologous expression of resistant mutants to confirm mechanism

This systematic validation cascade ensures that only genuine TSC10 inhibitors with potential for development are advanced through the discovery pipeline.

How should researchers interpret changes in sphingolipid profiles after TSC10 inhibition or mutation?

Interpreting changes in sphingolipid profiles following TSC10 inhibition or mutation requires systematic analysis and consideration of pathway relationships. Here's a methodological approach:

  • Expected primary effects of TSC10 inhibition:

    • Decrease in dihydrosphingosine (sphinganine) levels

    • Accumulation of 3-ketodihydrosphingosine (substrate)

    • Reduction in downstream sphingolipids (ceramides, complex sphingolipids)

  • Analytical methods for sphingolipid profiling:

    • Liquid chromatography-tandem mass spectrometry (LC-MS/MS):

      • Targeted approach focusing on known sphingolipid species

      • Untargeted lipidomics for broader pathway effects

    • Sphingolipid standards should be used for accurate quantification

    • Internal standards (isotopically labeled) should be employed to control for extraction efficiency

  • Data analysis framework:

    Sphingolipid ClassExpected Change with TSC10 InhibitionSignificance
    3-Ketodihydrosphingosine↑↑↑ (significant increase)Direct substrate accumulation
    Dihydrosphingosine↓↓↓ (significant decrease)Direct product reduction
    Dihydroceramides↓↓ (moderate decrease)Secondary effect - downstream
    Ceramides↓↓ (moderate decrease)Tertiary effect - further downstream
    Complex sphingolipids↓ (mild decrease)Quaternary effect - most downstream
    Salvage pathway lipids⟷ or ↑ (unchanged or increase)Potential compensatory upregulation
  • Interpretation guidelines:

    • Time-dependent analysis is crucial - early timepoints reflect direct enzyme inhibition, while later timepoints may show compensatory mechanisms

    • Partial inhibition may lead to subtle changes requiring careful statistical analysis

    • Consider species-specific differences in sphingolipid metabolism

    • Evaluate both relative (percent change) and absolute (concentration) differences

  • Confounding factors to consider:

    • Potential upregulation of salvage pathway as compensation

    • Changes in related lipid pathways (e.g., glycerolipids) due to metabolic rerouting

    • Stress responses that may independently alter lipid metabolism

    • Growth phase and media composition effects on baseline sphingolipid levels

  • Validation approaches:

    • Genetic complementation to confirm specificity of observed changes

    • Metabolic labeling (e.g., with ¹³C-serine) to track flux through the pathway

    • Correlation of sphingolipid changes with phenotypic effects

This systematic approach allows researchers to confidently attribute observed sphingolipid changes to TSC10 inhibition or mutation, distinguishing direct effects from secondary adaptations.

What statistical approaches are appropriate for analyzing structure-activity relationships of TSC10 inhibitors?

This systematic statistical approach allows researchers to extract meaningful structure-activity relationships from TSC10 inhibitor datasets, guiding rational optimization of lead compounds toward increased potency and selectivity.

How can researchers determine if TSC10 inhibition is responsible for observed antifungal activity?

Establishing a causal relationship between TSC10 inhibition and observed antifungal activity requires a multi-faceted approach. The following methodological framework provides a comprehensive validation strategy:

  • Target validation through genetic approaches:

    • Gene knockout/knockdown: Confirm that deletion or reduction of TSC10 leads to growth inhibition or similar phenotypes as the compound treatment

    • Overexpression studies: Demonstrate that increasing TSC10 expression reduces compound sensitivity (increased MIC)

    • Mutational analysis: Generate point mutations in TSC10 and test for resistance to compound

  • Biochemical correlation:

    • Establish dose-dependent relationship between:

      • Enzymatic inhibition (IC50 against purified TSC10)

      • Cellular activity (MIC against C. neoformans)

      • Sphingolipid metabolism disruption (metabolomic changes)

    • Compare across a series of structural analogs to demonstrate correlation between target potency and cellular activity

  • Target engagement in cells:

    • Cellular thermal shift assay (CETSA):

      • Demonstrates direct binding to target protein in intact cells

      • Can distinguish specific from non-specific mechanisms

    • Metabolomic profiling:

      • Accumulation of 3-ketodihydrosphingosine (substrate)

      • Depletion of dihydrosphingosine and downstream sphingolipids

      • Pattern should match genetic TSC10 deletion/inhibition

  • Resistance studies:

    • Generate resistant mutants through serial passage

    • Sequence TSC10 gene in resistant isolates

    • Express identified mutations in recombinant protein and confirm reduced inhibitor binding

    • Re-introduce wild-type TSC10 to restore sensitivity

  • Comparative studies with known inhibitors:

    • Compare phenotypic effects with other sphingolipid pathway inhibitors

    • Look for synergy or antagonism with inhibitors of related pathways

    • Examine cross-resistance patterns between different compounds

  • Selective toxicity demonstration:

    • Compare activity against fungal TSC10 vs. mammalian KDSR

    • Correlate selectivity ratios in enzyme assays with differential toxicity to fungal vs. mammalian cells

    • Demonstrate rescue of mammalian cells through exogenous sphingolipid supplementation if inhibition occurs

  • Chemical biology approaches:

    • Develop activity-based probes to directly visualize target engagement

    • Create biotinylated analogs for pull-down experiments

    • Use photoaffinity labeling to identify binding sites

This systematic approach provides multiple lines of evidence to confidently attribute antifungal activity to TSC10 inhibition, ruling out off-target effects or non-specific toxicity mechanisms.

What are the most promising approaches for developing TSC10 inhibitors with enhanced selectivity for fungal over mammalian enzymes?

Based on structural and functional data from cnTSC10, several strategic approaches show promise for developing selective inhibitors:

  • Targeting the non-conserved dimer interface:
    The crystal structure of cnTSC10 revealed that residues forming hydrogen bonds and salt bridges in the dimer interface are not conserved between fungal TSC10 and mammalian KDSR proteins . This represents a unique opportunity for selective targeting through:

    • Structure-based design of compounds that disrupt dimerization

    • Allosteric modulators that bind at the interface and alter enzyme conformation

    • Peptide-based inhibitors that mimic interface regions

  • Exploiting differences in catalytic site flexibility:
    The significant flexibility observed in the catalytic site of cnTSC10 may differ from mammalian KDSR, allowing for:

    • Inhibitors that capture fungal-specific conformational states

    • Compounds that stabilize inactive conformations preferentially in the fungal enzyme

    • Time-dependent inhibitors that benefit from difference in protein dynamics

  • Structure-guided approaches:

    StrategyRationaleExperimental Approach
    Fragment-based screeningIdentifies starting points for selective bindingThermal shift assays, NMR screening
    Virtual screening focused on unique pocketsLeverages structural differencesComputational docking to specific regions
    Selective covalent inhibitorsTarget unique cysteine residues in fungal enzymeMass spectrometry to confirm selectivity
    Transition state analogsExploit differences in reaction mechanismEnzyme kinetics with varied substrates
  • Biology-guided approaches:

    • Phenotypic screening in the presence of mammalian cells to identify inherently selective compounds

    • Focused screening of natural products from organisms that compete with fungi in their ecological niches

    • Repurposing screens of approved drugs to identify scaffolds with inherent selectivity

  • Combined chemistry and biology optimization:

    • Iterative optimization using parallel synthesis of analogs

    • Multi-parameter optimization balancing potency, selectivity, and drug-like properties

    • Utilization of structure-activity relationship data to guide medicinal chemistry efforts

These approaches leverage the unique structural features of fungal TSC10 to develop inhibitors with reduced potential for host toxicity, addressing a critical need in antifungal development.

What remaining questions about TSC10 structure and function would advance antifungal development efforts?

Despite significant progress in understanding TSC10, several critical knowledge gaps remain that, if addressed, would significantly advance antifungal development efforts:

  • Complete structural characterization:

    • Structure of full-length TSC10 including membrane-associated domains

    • Structures of enzyme-substrate complexes to fully elucidate the binding mode

    • Characterization of the disordered "substrate loop" in its active conformation

    • Understanding the structural basis for the equilibrium between dimeric and tetrameric forms

  • Detailed mechanistic insights:

    • Precise catalytic mechanism including proton transfer steps

    • Rate-limiting step identification through pre-steady-state kinetics

    • Role of protein dynamics in substrate recognition and catalysis

    • Potential allosteric regulation mechanisms

  • Biological roles and regulation:

    • Transcriptional and post-translational regulation in response to stress

    • Potential protein-protein interactions with other sphingolipid biosynthetic enzymes

    • Role in virulence and host-pathogen interactions

    • Compensation mechanisms when enzyme function is partially inhibited

  • Pharmacological considerations:

    • Identification of allosteric sites that could be targeted for inhibition

    • Drug penetration strategies to overcome the capsule barrier in C. neoformans

    • Resistance mechanisms that might emerge under selective pressure

    • Synergistic targets in related pathways

  • Comparative biology:

    • Conservation and differences across pathogenic Cryptococcus species and strains

    • Unique features of serotype D enzymes compared to other serotypes

    • Structural and functional comparison with TSC10 from other pathogenic fungi

    • Evolutionary analysis of structure-function relationships

Addressing these questions would provide crucial insights for rational drug design targeting TSC10 and accelerate the development of novel antifungals against Cryptococcus neoformans, addressing a significant unmet medical need especially for immunocompromised patients suffering from cryptococcal meningitis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.