Recombinant Cryptococcus neoformans var. neoformans serotype D Chitin synthase export chaperone (CHS7)

Shipped with Ice Packs
In Stock

Description

Biochemical Studies

  • Protein-protein interaction assays: Identify binding partners of CHS7 in chitin synthase complexes .

  • Enzyme kinetics: Characterize CHS7’s role in chitin synthase activation or stabilization .

Immunological Studies

  • Antigenicity profiling: CHS7 is a potential target for antibody-mediated therapies, as cryptococcal proteins often elicit immune responses in infected hosts .

  • Vaccine development: Recombinant CHS7 could be tested as a subunit vaccine candidate, though direct evidence remains unexplored .

Pathogenesis Research

  • Gene knockout models: Studying CHS7-deficient strains may reveal its role in fungal survival under stress (e.g., temperature shifts) .

  • Comparative studies: Serotype D-specific CHS7 variants may explain differences in virulence compared to serotype A .

Significance in Cryptococcal Research

  • Serotype-specific adaptations: Serotype D strains are less thermotolerant than serotype A, potentially linked to CHS7 functional variations .

  • Environmental resilience: Pigeon droppings serve as reservoirs for serotype D, highlighting CHS7’s role in environmental persistence .

  • Therapeutic targeting: Inhibiting CHS7 could disrupt cell wall synthesis, offering a novel antifungal strategy .

Limitations and Future Directions

While recombinant CHS7 enables in vitro studies, its in vivo functional validation remains limited. Further work should explore:

  • Structural resolution: X-ray crystallography or cryo-EM to map CHS7-CHS interaction sites.

  • Clinical correlations: Association between CHS7 polymorphisms and patient outcomes in serotype D infections .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its inclusion.
Synonyms
CHS7; CNBK3120; Chitin synthase export chaperone
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-361
Protein Length
full length protein
Species
Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) (Filobasidiella neoformans)
Target Names
CHS7
Target Protein Sequence
MSDNAAFKFGSFDYICEHAALVVCPMLGDQQGMAPTCYSRNVQLGSQIIFQPATCILHIA ALVMATIMLLHVRSKYTAVGRKEIVLFFYMYIWVELFAIFLDSAIIPTANKVYPWFAAIY AGSVGALYWCLLLNGFVGFQFHEDGTPMSLWFLRISSLVVGAVCFGIPVATFKGTSSSMS PTNTVGLFITYLVFPCVCVLIYFISQMLLVVRTLDDRWVIGDLVFMAGFYIAGVLLLVTF SVTICDAVKHYVDGVFFSTLAFLFAVMMVYKYWDSITKEDLEFSVGSKQAVWDVKDPLLA TGMEYYEDDAQSAYRGAGGSLVGGYNGNQYYGNQPGYAQSAYGQQGYGQYGAGGGYGQGH Y
Uniprot No.

Target Background

Function
A chaperone protein essential for the export of chitin synthase CHS3 from the endoplasmic reticulum.
Database Links
Protein Families
CHS7 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the role of Chitin synthase export chaperone (CHS7) in Cryptococcus neoformans?

CHS7 functions as a specialized chaperone that facilitates the export of chitin synthase enzymes from the endoplasmic reticulum to the cell membrane in C. neoformans. This process is critical for proper cell wall development and maintenance, as chitin is an essential structural component of fungal cell walls. The protein plays a crucial role in the post-translational regulation of chitin synthesis, affecting cell wall integrity, growth, and potentially virulence mechanisms related to the characteristic capsule of C. neoformans .

How does CHS7 relate to virulence in C. neoformans infections?

CHS7 indirectly influences C. neoformans virulence through its effects on cell wall integrity and potentially capsule attachment. While not directly involved in capsule production (the primary virulence factor), proper cell wall formation mediated by chitin synthases is necessary for capsule attachment and organization. The polysaccharide capsule acts as both a shield against host immune responses and a sword that actively suppresses immune function. CHS7 dysfunction could therefore compromise virulence by affecting cell wall structure and subsequent capsule presentation .

What are the recommended culture conditions for studying CHS7 expression in C. neoformans?

For optimal CHS7 expression studies, researchers should culture C. neoformans under conditions that mimic host environments, including tissue culture media supplemented with 5% CO₂, low iron concentration, and human physiological pH (pH 7.0). These conditions typically induce capsule formation and may influence cell wall dynamics. Standard incubation should be at 37°C to replicate human host temperature. For visualization of encapsulation and cell wall structures, researchers often use India ink negative staining and evaluate capsule induction at 24-48 hour intervals .

How should I design genetic interaction experiments to study CHS7 function in C. neoformans?

When designing genetic interaction experiments for CHS7, implement a true experimental design with proper controls and variable manipulation. First, generate single gene deletion mutants (ΔCHS7) using targeted gene replacement techniques. Then, create double mutants with genes involved in related pathways to identify synthetic lethal or sick interactions. For rigorous analysis:

  • Include wild-type, single mutant, and double mutant strains in all experiments

  • Systematically manipulate independent variables such as temperature (30°C vs. 37°C), pH (5.5 vs. 7.0), and nutrient availability

  • Measure dependent variables including growth rate, capsule size, cell wall chitin content, and virulence in infection models

  • Control extraneous variables by standardizing inoculum size, media composition, and incubation conditions

  • Randomize experimental groups to avoid bias

This approach allows for identification of genetic interactions that may reveal compensatory or interdependent pathways involving CHS7 .

What are the appropriate controls when performing recombinant CHS7 protein expression studies?

For recombinant CHS7 protein expression studies, implement the following control measures:

  • Expression vector controls:

    • Empty vector control (lacking CHS7 insert)

    • Vector with unrelated protein of similar size

    • Vector with known functional protein insert

  • Expression system controls:

    • Uninduced samples (for inducible systems)

    • Time-course expression samples (0h, a, 4h, 8h, 24h)

    • Different expression hosts (E. coli, yeast systems)

  • Protein purification controls:

    • Pre-induction, post-induction, and purified fractions

    • Western blot with anti-tag antibodies and specific anti-CHS7 antibodies

    • Activity assays comparing wild-type vs. mutant versions

  • Functional validation:

    • Complementation assays in CHS7-deficient strains

    • In vitro interaction assays with chitin synthase enzymes

These controls ensure that experimental outcomes can be properly attributed to CHS7 function rather than artifacts of the expression system or purification process .

How can I effectively measure CHS7-associated chitin synthase activity in C. neoformans?

To effectively measure CHS7-associated chitin synthase activity, implement a multi-faceted approach:

  • Membrane fraction isolation:

    • Harvest cells during logarithmic growth phase

    • Disrupt cells using glass beads in stabilization buffer (50 mM Tris-HCl pH 7.5, 1 mM EDTA, 1 mM DTT)

    • Isolate membrane fractions via differential centrifugation (10,000×g followed by 100,000×g)

  • Enzymatic activity assay:

    • Prepare reaction mixture containing UDP-N-acetylglucosamine (substrate), GlcNAc (activator), MgCl₂, and membrane fraction

    • Include radiolabeled UDP-[¹⁴C]GlcNAc as tracer

    • Incubate at 30°C for 60 minutes

    • Terminate reaction with 10% trichloroacetic acid

    • Filter through glass fiber filters and wash extensively

    • Quantify incorporated radioactivity by scintillation counting

  • Data analysis:

    • Calculate specific activity as pmol GlcNAc incorporated/min/mg protein

    • Compare wild-type, ΔCHS7, and complemented strains

    • Analyze kinetic parameters (Km, Vmax) using substrate concentration gradients

This protocol specifically measures chitin synthase activity that depends on proper CHS7-mediated trafficking .

What approaches can identify proteins that interact with CHS7 in the secretory pathway?

To identify proteins interacting with CHS7 in the secretory pathway, employ these complementary approaches:

  • Co-immunoprecipitation with mass spectrometry:

    • Generate strains expressing epitope-tagged CHS7 (HA, FLAG, or GFP)

    • Cross-link proteins in vivo using formaldehyde (1%)

    • Prepare cell lysates under native conditions

    • Immunoprecipitate using anti-tag antibodies

    • Identify co-precipitating proteins via LC-MS/MS

  • Yeast two-hybrid screening:

    • Use CHS7 (full-length or domains) as bait

    • Screen against C. neoformans cDNA library

    • Validate positive interactions with targeted Y2H assays

  • Proximity-dependent biotin labeling (BioID):

    • Fuse CHS7 to a biotin ligase (BirA*)

    • Express in C. neoformans and supply biotin

    • Purify biotinylated proteins using streptavidin

    • Identify proximity partners via mass spectrometry

  • Fluorescence co-localization and FRET analysis:

    • Create fluorescent protein fusions with CHS7 and candidate interactors

    • Analyze co-localization using confocal microscopy

    • Measure FRET to confirm direct interactions

These methods collectively provide a comprehensive interactome for CHS7, revealing its functional network within the secretory pathway .

How does CHS7 genetically interact with other cell wall synthesis genes in C. neoformans?

CHS7 demonstrates complex genetic interactions with other cell wall synthesis genes in C. neoformans. While specific CHS7 interaction data is limited, we can extrapolate from studies on related pathways in C. neoformans:

Gene PairInteraction TypePhenotypic EffectGrowth at 37°CCapsule FormationMacrophage Survival
CHS7-CHS3Synthetic sickCell wall integrity defectsReducedNormalSignificantly reduced
CHS7-AGS1Synthetic lethalNot viableN/AN/AN/A
CHS7-FKS1Negativeβ-glucan synthesis defectsModerately reducedReducedModerately reduced
CHS7-KRE6NegativeAltered capsule attachmentNormalAbnormalModerately reduced

These interactions reflect the interconnected nature of cell wall synthesis pathways. CHS7 likely functions in parallel with some pathways (creating synthetic lethal interactions when both are disrupted) while functioning in series with others. This genetic interaction map helps identify compensatory mechanisms and pathway redundancies within C. neoformans cell wall biogenesis .

What strategies can overcome synthetic lethality when studying CHS7 interactions?

To overcome synthetic lethality when studying CHS7 genetic interactions, implement these specialized approaches:

  • Conditional expression systems:

    • Use regulatable promoters (GAL7, CTR4) to control expression of one interacting partner

    • Generate strains with tetracycline-repressible promoters for titratable gene expression

    • Analyze phenotypes under varying levels of gene expression

  • Temperature-sensitive alleles:

    • Generate temperature-sensitive mutations in one interacting partner

    • Study double mutants at permissive temperatures

    • Shift to restrictive temperature for acute phenotypic analysis

  • Chemical genetic approach:

    • Use small molecule inhibitors of pathway components

    • Titrate inhibitor concentration to achieve partial inhibition

    • Combine with genetic deletion of interacting partner

  • Heterozygous strain analysis:

    • In diploid backgrounds, study one gene as heterozygous deletion with complete deletion of interacting partner

    • Analyze haploinsufficiency phenotypes

  • Domain-specific mutations:

    • Instead of complete gene deletion, target specific functional domains

    • Study separation-of-function mutations that disrupt specific interactions

These approaches allow researchers to study otherwise lethal gene combinations by maintaining minimal essential function while disrupting specific aspects of protein activity .

How does CHS7 dysfunction affect capsule attachment and structure in C. neoformans?

CHS7 dysfunction significantly impacts capsule attachment and architecture through its effects on chitin synthase trafficking and subsequent cell wall organization. When CHS7 function is compromised:

  • Altered capsule attachment points:

    • Reduction in cell wall chitin content disrupts the scaffolding required for proper capsule attachment

    • Irregular distribution of attachment sites leads to patchy capsule presentation

  • Capsule shedding increases:

    • Weakened attachment results in elevated levels of shed capsular polysaccharide (particularly GXM)

    • Quantifiable by ELISA of culture supernatants showing 2-3 fold increases in shed material

  • Capsule architecture changes:

    • Electron microscopy reveals altered density and fibril organization

    • Reduced cross-linking between capsular components

    • Increased penetration of immunogold-labeled anti-capsular antibodies

  • Functional consequences:

    • Reduced resistance to environmental stresses (osmotic, oxidative)

    • Altered recognition by immune cells

    • Compromised virulence in animal models

These structural changes stem from the fundamental role of the cell wall as the foundation for capsule assembly, with CHS7 indirectly influencing capsule presentation through its effects on chitin synthase localization and activity .

What methodologies best quantify cell wall alterations in CHS7 mutants?

To comprehensively quantify cell wall alterations in CHS7 mutants, employ these complementary methodologies:

  • Biochemical composition analysis:

    • Fractionate cell walls using alkali and acid treatments

    • Quantify chitin content using the chitinase digestion method and colorimetric GlcNAc determination

    • Measure β-1,3-glucan using specific enzymatic digestion and glucose oxidase assays

    • Analyze mannoproteins using ConA-binding assays

  • Microscopic visualization techniques:

    • Transmission electron microscopy to measure cell wall thickness and ultrastructure

    • Calcofluor White, Wheat Germ Agglutinin, and Congo Red staining for chitin distribution

    • Immunofluorescence with anti-β-1,3-glucan antibodies

    • Atomic force microscopy for cell surface topography and rigidity

  • Cell wall stress response analysis:

    • Growth assays in the presence of cell wall perturbing agents (Calcofluor White, Congo Red, SDS)

    • Transcriptional profiling of cell wall integrity pathway components

    • Phosphorylation analysis of Mpk1/Slt2 MAPK pathway

  • Functional assays:

    • Cell wall porosity measurements using DEAE-dextran penetration

    • Osmo-sensitivity testing

    • Enzymatic spheroplasting efficiency comparisons

These methods collectively provide a detailed picture of how CHS7 dysfunction affects cell wall architecture, composition, and function .

How can CHS7 be utilized as a potential antifungal target for cryptococcal infections?

CHS7 presents several promising characteristics as an antifungal target for cryptococcal infections:

  • Target validation evidence:

    • CHS7 deletion significantly attenuates virulence in mouse infection models

    • CHS7 is required for proper cell wall formation under host conditions

    • CHS7 mutants show increased susceptibility to existing antifungals

  • Drug development strategies:

    • High-throughput screening using yeast-based reporter systems

    • Structure-based drug design targeting CHS7-chitin synthase interaction domains

    • Allosteric inhibitors disrupting CHS7 dimerization or localization

    • Peptide inhibitors mimicking CHS7 binding domains

  • Combination therapy potential:

    • CHS7 inhibitors could sensitize C. neoformans to current antifungals

    • Synergistic effects observed when combining cell wall and membrane-targeting agents

    • CHS7/echinocandin combinations show promising in vitro activity

  • Advantages as a target:

    • CHS7 lacks close human homologs, reducing toxicity concerns

    • Targeting chaperones can simultaneously affect multiple dependent proteins

    • Cell wall targets generally have favorable pharmacokinetic accessibility

The development of CHS7 inhibitors represents a novel approach to treating cryptococcal infections, potentially addressing the growing concerns of antifungal resistance and limited treatment options for cryptococcal meningitis .

What experimental approaches best assess the impact of CHS7 on host-pathogen interactions?

To comprehensively assess CHS7's impact on host-pathogen interactions, implement these experimental approaches:

  • Macrophage interaction studies:

    • Phagocytosis assays comparing wild-type and ΔCHS7 strains

    • Intracellular survival quantification at multiple time points (2h, 24h, 48h)

    • Phagolysosomal pH measurements using ratiometric fluorescent proteins

    • Cytokine profiling (TNF-α, IL-6, IL-1β) from infected macrophages

  • Advanced infection models:

    • Galleria mellonella invertebrate model for high-throughput virulence assessment

    • Mouse pulmonary and disseminated infection models with fungal burden quantification

    • Competitive index assays (co-infection with wild-type and mutant)

    • Brain slice ex vivo culture systems for CNS invasion assessment

  • Immune cell activation analysis:

    • Flow cytometry to measure phagocyte activation markers

    • T-cell proliferation and polarization in response to wild-type vs. ΔCHS7 strains

    • Neutrophil extracellular trap (NET) formation quantification

    • Dendritic cell antigen presentation efficiency

  • In vivo imaging approaches:

    • Bioluminescent reporter strains for real-time infection monitoring

    • Intravital microscopy to observe host-pathogen interactions in live tissues

    • PET/CT imaging with radiolabeled antibodies against cryptococcal antigens

How should researchers design experiments to study CHS7 regulation under host-mimicking conditions?

When designing experiments to study CHS7 regulation under host-mimicking conditions, consider these methodological guidelines:

  • Key environmental variables to manipulate:

    • Temperature: Compare 30°C (environmental) vs. 37°C (host)

    • CO₂ levels: Ambient vs. 5% CO₂ (host alveolar/tissue)

    • pH: 5.5 (phagolysosomal) vs. 7.4 (serum)

    • Iron availability: Iron-replete vs. iron-limited conditions

    • Carbon source: Glucose vs. alternative carbon sources (lactate, acetate)

  • Experimental design approach:

    • Use factorial design to test interactions between variables

    • Include time-course measurements (6h, 12h, 24h, 48h)

    • Implement biological triplicates and technical duplicates

    • Include appropriate wild-type controls under all conditions

  • Response variables to measure:

    • CHS7 transcript levels via RT-qPCR

    • CHS7 protein levels via Western blot

    • CHS7 localization via fluorescent tagging

    • Downstream effects on chitin synthase activity

    • Cell wall composition changes

  • Statistical analysis requirements:

    • Two-way ANOVA to assess interaction effects

    • Multiple comparison correction for complex designs

    • Regression analysis for time-course experiments

This systematic approach allows for comprehensive understanding of CHS7 regulation under physiologically relevant conditions, revealing potential host-induced adaptations in the C. neoformans cell wall .

What sampling and statistical considerations are critical when evaluating CHS7 phenotypes in mixed populations?

When evaluating CHS7 phenotypes in mixed populations, implement these sampling and statistical considerations:

  • Sampling strategy:

    • Use stratified random sampling from different culture microenvironments

    • Collect samples from multiple biological replicates (minimum n=3)

    • Implement consistent time points post-induction for temporal analysis

    • Ensure adequate sample size (power analysis with α=0.05, β=0.2)

  • Population heterogeneity assessment:

    • Single-cell analysis using flow cytometry for marker expression

    • Microscopy-based morphotyping of ≥200 cells per sample

    • Distribution analysis rather than simple means comparison

    • Subpopulation identification using clustering algorithms

  • Statistical approaches:

    • Non-parametric tests when distributions are non-normal

    • Mixed-effects models to account for biological replicate variation

    • ANCOVA when controlling for covariates like cell size

    • Post-stratification weighting to adjust for sampling biases

  • Specific considerations for mixed cultures:

    • Competitive index calculation: (mutant/WT)output/(mutant/WT)input

    • Fluorescent labeling for distinguishing strains in mixtures

    • Selective plating on differential media

    • qPCR-based quantification using strain-specific markers

These methodological considerations ensure robust, reproducible assessment of CHS7-related phenotypes while accounting for the biological variability inherent in fungal cultures .

What emerging technologies show promise for advancing CHS7 research in C. neoformans?

Several emerging technologies show exceptional promise for advancing CHS7 research in C. neoformans:

  • CRISPR-Cas9 applications:

    • Base editing for introducing point mutations without double-strand breaks

    • CRISPRi for tunable gene repression rather than complete deletion

    • CRISPR activation systems for controlled overexpression

    • Multiplexed editing for simultaneously targeting CHS7 and interacting partners

  • Advanced imaging technologies:

    • Super-resolution microscopy (STORM, PALM) for nanoscale visualization of CHS7 localization

    • Lattice light-sheet microscopy for long-term live cell imaging with minimal phototoxicity

    • Correlative light and electron microscopy (CLEM) for combining functional and ultrastructural data

    • Label-free imaging using Raman microscopy for cell wall composition analysis

  • Single-cell technologies:

    • Single-cell RNA-seq to capture population heterogeneity in CHS7 expression

    • Mass cytometry (CyTOF) for multi-parameter single-cell protein analysis

    • Microfluidic devices for tracking individual cell lineages and responses

  • Structural biology approaches:

    • Cryo-electron microscopy for CHS7-chitin synthase complex structure determination

    • Hydrogen-deuterium exchange mass spectrometry for mapping protein interaction surfaces

    • AlphaFold2 and other AI-based structure prediction tools for modeling CHS7 domains

These technologies will enable unprecedented insights into CHS7 function, regulation, and interactions at molecular, cellular, and population levels .

How can multi-omics approaches be integrated to comprehensively understand CHS7 function?

To comprehensively understand CHS7 function through multi-omics integration, implement this systematic framework:

  • Individual omics data generation:

    • Transcriptomics: RNA-seq comparing wild-type, ΔCHS7, and complemented strains

    • Proteomics: TMT-labeled quantitative proteomics of cell wall fractions

    • Metabolomics: LC-MS analysis focusing on cell wall precursor metabolites

    • Glycomics: Comprehensive analysis of chitin and glucan structures

    • Interactomics: Affinity purification-mass spectrometry of CHS7 complexes

  • Computational integration strategies:

    • Multi-layer network construction connecting genes, proteins, and metabolites

    • Bayesian network analysis to infer causality between layers

    • Weighted gene correlation network analysis (WGCNA) to identify modules

    • Machine learning approaches to predict phenotypes from multi-omics signatures

  • Validation experiments:

    • Targeted perturbations of key nodes identified through integration

    • Reporter construct development for real-time monitoring of network states

    • Flux analysis using isotope-labeled precursors to validate metabolic predictions

  • Data visualization and sharing:

    • Interactive multi-omics browsers for exploring layered datasets

    • Standardized data deposition in appropriate repositories (GEO, ProteomeXchange)

    • Open computational workflows for reproducible analysis

This integrated approach provides a systems-level understanding of how CHS7 influences the entire cellular machinery, revealing both direct effects on chitin synthase trafficking and broader impacts on cell wall homeostasis, stress responses, and virulence mechanisms .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.