Recombinant Cryptococcus neoformans var. neoformans serotype D GPI inositol-deacylase (BST1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please specify this in your order remarks. We will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, briefly centrifuge the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be decided during production. If you have a preferred tag type, please inform us, and we will prioritize its development.
Synonyms
BST1; CNF03000; GPI inositol-deacylase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-768
Protein Length
full length protein
Species
Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) (Filobasidiella neoformans)
Target Names
BST1
Target Protein Sequence
MPAWPRFMSLRRQYLYKALDKNHQKHPIKHPHTRFLSRLFCALAVLFSYSIYQSFRTDLK QSGSWGCEMSWMSPSYRRLEWTEFISTRYALYLYREQGLDSEDTLSGHPVLFVPGNAGSY QQVRSIASSASKQYYEQVKARERNVVTGKKIDFFTADLKEEFSAFHARTVREQAVFIQHC IKGILQEYTHLPQEKRPTQVTLLAHSMGGVVARLAMDPITSISVDIIVTLSTPHILPPLA LERDMDSIYSLIRWRRQHISTHPPLISICGGISDTQIVSDSCALPFFQAGNNSDIAVFTT GIPGVWTAVEHQAIIWCHQIRWRIARMLLDMSSRANTTAKLVTAKEWLLDYQEDETLKEP RSERQHDYSVSSRNMTFIGLHQPSKAFVAQQCNGLERCRTVPSVMSLLPFPNNPSDPFPL PGEGIKPSEVMLVAEISLSSTNTVVKINASQYGQTIAGSREHHLVKGNSWSEFTITMRYR YIRIQLLFCIRPTHTSTFSFYCGTLLTLPRQSWHLSGDISIALMSCTTGVAQKKLLQRTG QICDSVPYGRSCMASRVGYCGSSVSIIRFYQHRSVRTCKGFKLILVGEILPWNSALERIA RRRMPICIVLLLLGATIQSQLPDFPMLHTFFLGVNQLEMVPLVGILGVWTFGLLCVVSFH LISTCAIFTTLLIPFKILHVAIWSRNIWTGSAALVSTDNNFYYAIPPVLLVKCASCGGTI QKRHVCLKACRIALIILIMSSFSVGARWTWILSPIANAVLILFVASII
Uniprot No.

Target Background

Function
GPI inositol-deacylase (BST1) is involved in inositol deacylation of GPI-anchored proteins. This process plays critical roles in the quality control and ER-associated degradation of GPI-anchored proteins.
Database Links
Protein Families
GPI inositol-deacylase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the function of BST1 in Cryptococcus neoformans?

BST1 (GPI inositol-deacylase) in Cryptococcus neoformans is responsible for the inositol deacylation of GPI-anchored proteins (GPI-APs). Based on homology with BST1 in Candida albicans, it likely facilitates proper cell wall anchorage of GPI-APs by removing the acyl group from the inositol ring of the GPI anchor . This post-translational modification is crucial for the correct localization and function of numerous cell wall proteins that contribute to fungal virulence. The enzymatic activity centers on a conserved serine residue within the catalytic domain, similar to the serine-202 identified in C. albicans BST1 .

How does BST1 differ from other proteins involved in GPI-anchor processing?

BST1 specifically catalyzes the inositol deacylation step in GPI-anchor processing, which distinguishes it from other enzymes in the GPI biosynthetic pathway. Unlike phospholipases that cleave the entire GPI anchor or glycosidases that modify carbohydrate portions, BST1 removes only the acyl group from the inositol ring. This specific modification affects how GPI-APs interact with phospholipases like PI-PLC, as demonstrated in C. albicans where BST1-deficient strains produce GPI-APs resistant to PI-PLC treatment . In the context of Cryptococcus, this distinction is particularly important given the significance of properly anchored cell wall proteins for virulence, as evidenced by the SEC14-dependent secretion of phospholipase B1 (CnPlb1) required for cryptococcal pathogenesis .

What experimental approaches are used to study BST1 activity in fungal systems?

Several methodological approaches are effective for studying BST1 activity in fungal systems:

  • Enzymatic assays: Extracting cytoplasmic proteins and testing their resistance to phosphatidylinositol-specific phospholipase C (PI-PLC) treatment. GPI-APs from BST1-deficient strains typically show resistance to PI-PLC cleavage .

  • Lectin binding assays: Using peroxidase-labeled concanavalin A (ConA) to bind mannose residues of GPI-anchors, followed by analysis of their susceptibility to PI-PLC .

  • Site-directed mutagenesis: Creating strains with mutations in the putative catalytic site (e.g., serine to alanine mutations) to confirm enzymatic function, as performed with the S202A mutation in C. albicans BST1 .

  • Cell wall integrity tests: Assessing sensitivity to cell wall perturbing agents like SDS and calcofluor white, which can reveal defects in GPI-AP incorporation similar to tests used for SEC14 mutants in C. neoformans .

How does inositol deacylation by BST1 influence fungal virulence mechanisms?

Inositol deacylation of GPI-APs by BST1 plays a critical role in fungal virulence through multiple interconnected mechanisms. In C. albicans, BST1 deficiency severely impairs cell wall anchorage of GPI-APs, leading to unmasked β-(1,3)-glucan exposure and compromised invasive ability . This structural alteration enhances host immune recognition, as demonstrated by attenuated virulence and reduced organ colonization in murine systemic candidiasis models .

In the context of C. neoformans, the parallel can be drawn to SEC14-dependent secretion pathways, where proper processing and localization of virulence factors like phospholipase B1 (CnPlb1) are essential for CNS dissemination . The SEC14 deletion mutants, which show impaired secretion of CnPlb1, exhibit hypovirulence in mice and fail to disseminate to the CNS by day 14 post-infection, suggesting that proper protein modification and trafficking are prerequisites for full virulence . Since BST1-mediated inositol deacylation is a critical step in GPI-AP processing, it likely influences similar virulence mechanisms in C. neoformans, affecting host invasion, immune evasion, and dissemination capabilities.

What are the methodological considerations when performing BST1 knockout studies in Cryptococcus neoformans?

When conducting BST1 knockout studies in C. neoformans, researchers should consider several methodological factors to ensure robust and interpretable results:

  • Strain selection and verification: Use appropriate serotype D strains with verified genotypes. Confirm knockouts through PCR, Southern blotting, and functional assays that assess inositol deacylation activity.

  • Complementation controls: Include reconstituted strains to confirm that observed phenotypes are due to BST1 deletion rather than secondary mutations. Also consider creating catalytic site mutants (e.g., serine to alanine substitutions) to distinguish between protein absence and enzymatic inactivity .

  • Phenotypic assays: Implement comprehensive phenotypic characterization including:

    • Cell wall integrity tests using SDS and calcofluor white

    • GPI-AP localization studies using fluorescent protein tagging or ConA labeling

    • PI-PLC sensitivity assays to confirm loss of inositol deacylation

    • Virulence factor analysis, particularly examining proteins known to be GPI-anchored

  • Infection models: For virulence assessment, use appropriate infection models with consideration of:

    • Mouse background (strain variations can affect outcomes)

    • Inoculum size (calibrate carefully as different mutants may require adjusted doses)

    • Infection route (intravenous for dissemination studies vs. pulmonary for natural infection)

    • Time points (early time points may reveal differences in initial establishment vs. dissemination)

  • Cross-species comparison: Consider parallel experiments in C. albicans to establish functional conservation or divergence of BST1 between fungal species .

How does BST1-mediated processing interact with SEC14-dependent secretion pathways?

The potential interaction between BST1-mediated GPI-AP processing and SEC14-dependent secretion pathways represents an intriguing area of research with implications for understanding fungal virulence regulation. While direct evidence of their interaction in C. neoformans is limited in the provided search results, several hypotheses can be formulated based on known mechanisms:

SEC14 in C. neoformans is essential for the secretion of phospholipase B1 (CnPlb1), a GPI-anchored protein crucial for dissemination to the CNS . The SEC14 protein functions as a phosphatidylinositol transfer protein (PITP), regulating vesicle formation and secretion through maintenance of Golgi phosphatidylcholine levels . Concurrently, BST1 mediates inositol deacylation of GPI-APs, which affects their proper localization in the cell wall .

The intersection likely occurs at the level of GPI-AP processing and trafficking. Properly deacylated GPI-APs may interact differently with vesicular transport machinery regulated by SEC14, potentially affecting:

  • Vesicle budding efficiency: BST1-processed GPI-APs may influence membrane curvature or lipid raft formation required for SEC14-dependent vesicle budding.

  • Cargo selection: The inositol deacylation status might serve as a quality control checkpoint for incorporation into specific transport vesicles.

  • Cell wall integration: Both pathways ultimately affect the proper incorporation of virulence factors into the cell wall, as evidenced by similar phenotypes (SDS sensitivity, calcofluor white sensitivity) in both SEC14 and PLB1 deletion mutants .

Experimental approaches to investigate this interaction could include double mutant analyses (BST1/SEC14), co-localization studies of pathway components, and pulse-chase experiments tracking GPI-AP trafficking in various genetic backgrounds.

How does BST1 activity in C. neoformans affect immune recognition and vomocytosis?

BST1 activity likely influences immune recognition and vomocytosis (non-lytic expulsion from macrophages) through its impact on cell wall structure and GPI-anchored protein presentation. Based on findings with related proteins, we can infer several mechanisms:

The SEC14-dependent secretion of CnPlb1 in C. neoformans significantly impacts vomocytosis, with CnPlb1-deficient strains showing approximately 60% reduction in vomocytosis rates compared to wild-type strains . Similarly, SEC14 deletion mutants exhibited a 40% reduction in vomocytosis . This process is crucial for cryptococcal dissemination, as it allows the pathogen to escape macrophage killing while preserving both the host cell and the fungus.

In C. albicans, BST1 deficiency results in severely impaired cell wall anchorage of GPI-APs and subsequent unmasking of β-(1,3)-glucan, leading to enhanced recognition by host immune systems . By analogy, BST1 deficiency in C. neoformans would likely alter cell wall composition and expose pathogen-associated molecular patterns (PAMPs), potentially affecting:

  • Pattern recognition receptor (PRR) activation: Increased exposure of β-glucans and mannans could enhance recognition by Dectin-1 and mannose receptors on phagocytes.

  • Inflammatory response modulation: Altered eicosanoid production (which depends on CnPlb1) could impact the inflammatory environment surrounding infected cells .

  • Vomocytosis efficiency: Since vomocytosis depends on proper CnPlb1 function, which requires correct GPI anchoring, BST1 deficiency would likely reduce vomocytosis rates similar to what is observed in SEC14 and PLB1 mutants .

Experimental approaches to test these hypotheses would include time-lapse microscopy of macrophage-Cryptococcus interactions, cytokine profiling, and comparisons of vomocytosis rates between wild-type and BST1-deficient strains.

What is the relationship between BST1 function and cryptococcal dissemination to the central nervous system?

The relationship between BST1 function and cryptococcal dissemination to the central nervous system (CNS) likely stems from its role in GPI-AP processing and subsequent effects on virulence factors required for BBB crossing. While direct evidence for BST1's role in CNS dissemination of C. neoformans is not provided in the search results, we can make informed inferences:

Studies have established that CnPlb1, a GPI-anchored phospholipase, is essential for cryptococcal dissemination to the CNS . SEC14 deletion mutants with impaired CnPlb1 secretion failed to disseminate to the CNS by day 14 post-infection in a murine model . Since proper GPI anchoring is required for CnPlb1 function, and BST1 mediates a critical step in GPI-AP processing, BST1 deficiency would likely impair CNS dissemination through similar mechanisms.

The process likely involves multiple steps affected by BST1 function:

  • Initial establishment in lungs: Properly processed GPI-APs contribute to cell wall integrity and resistance to host defense mechanisms in the lungs.

  • Vascular invasion: CnPlb1 activity facilitates penetration of vascular boundaries, which requires proper GPI processing potentially mediated by BST1.

  • BBB crossing: Transmigration across the blood-brain barrier depends on specific cryptococcal factors that may require BST1-mediated processing.

  • Vomocytosis-facilitated dissemination: The reduced vomocytosis observed in CnPlb1-deficient strains contributes to reduced dissemination , suggesting that BST1's effect on GPI-AP processing would similarly impact this dissemination mechanism.

Comparative analysis between C. albicans BST1 and C. neoformans BST1 is instructive: BST1-deficient C. albicans exhibited severely attenuated virulence and reduced organ colonization in systemic candidiasis models , suggesting that BST1 in C. neoformans would similarly impact systemic dissemination capabilities.

What are the optimal expression systems for producing recombinant C. neoformans BST1 for structural studies?

For successful structural studies of recombinant C. neoformans BST1, researchers should consider several expression systems, each with specific advantages:

  • Yeast expression systems:

    • Saccharomyces cerevisiae: Provides proper eukaryotic post-translational modifications and has well-established protocols for membrane protein expression. Given that BST1 is an ER/Golgi-resident protein in fungi, S. cerevisiae offers a natural environment for functional expression.

    • Pichia pastoris: Offers high expression levels and proper protein folding for eukaryotic proteins. Its strong inducible promoters (AOX1) allow controlled expression, and its growth to high cell densities enhances yield.

  • Insect cell systems:

    • Baculovirus-infected Sf9/Sf21 or High Five cells: Excellent for expressing complex eukaryotic proteins requiring post-translational modifications. The larger scale of these cultures compared to mammalian cells makes them suitable for structural biology applications.

  • Mammalian cell expression:

    • HEK293 or CHO cells: Provide mammalian-type glycosylation and may be considered when native-like modifications are crucial for structural studies.

For BST1 specifically, consider these technical parameters:

  • Construct design:

    • Include appropriate purification tags (His6, FLAG, etc.) at either N- or C-terminus, with TEV protease cleavage sites

    • Consider removing transmembrane domains while preserving the catalytic domain for improved solubility

    • Create fusion constructs with stability-enhancing partners (MBP, SUMO, etc.) if expression or solubility is problematic

  • Purification strategy:

    • Employ detergent screening (DDM, LMNG, GDN, etc.) for membrane-associated forms

    • Use immobilized metal affinity chromatography followed by size exclusion chromatography

    • Consider lipid nanodisc or amphipol reconstitution for maintaining native-like environment

  • Activity verification:

    • Develop an in vitro assay using synthetic GPI anchors or suitable substrate analogs

    • Monitor PI-PLC sensitivity of purified protein-treated GPI-APs as a functional readout

The choice between these systems should be guided by the specific requirements of the structural technique to be employed (X-ray crystallography, cryo-EM, or NMR) and the quantity and quality of protein required.

What are the key considerations for designing inhibitors targeting BST1 in Cryptococcus neoformans?

Designing effective and selective inhibitors targeting BST1 in C. neoformans requires a multi-faceted approach considering structural, biochemical, and pharmacological properties:

  • Structural considerations:

    • Target the catalytic serine residue analogous to serine-202 in C. albicans BST1

    • Focus on the inositol-binding pocket that accommodates the GPI anchor substrate

    • Exploit structural differences between fungal BST1 and mammalian PGAP1 (homologous enzyme) to achieve selectivity

    • Consider the membrane-associated nature of BST1 in inhibitor design (lipophilicity, membrane penetration)

  • Biochemical profiling:

    • Develop high-throughput screening assays using recombinant BST1 and synthetic GPI anchor substrates

    • Establish structure-activity relationships through systematic modification of lead compounds

    • Screen for inhibitors that prevent PI-PLC sensitivity restoration, which indicates blocked inositol deacylation

    • Test inhibitor effects on cell wall integrity using SDS and calcofluor white sensitivity assays

  • Pharmacological properties:

    • Optimize for antifungal-appropriate pharmacokinetics (blood-brain barrier penetration is essential for treating cryptococcal meningitis)

    • Balance between hydrophilicity (for solubility) and lipophilicity (for membrane penetration and target engagement)

    • Consider formulation strategies for enhancing bioavailability in infected tissues

    • Design with resistance development consideration, potentially targeting conserved catalytic mechanisms

  • Validation approaches:

    • Compare inhibitor effects with BST1 knockout phenotypes to confirm on-target activity

    • Test efficacy in reducing virulence factors secretion and vomocytosis rates

    • Evaluate inhibitor effects on cryptococcal dissemination to the CNS in animal models

    • Assess cross-reactivity with other GPI processing enzymes to predict potential side effects

The ultimate goal is to develop inhibitors that disrupt BST1-mediated GPI-AP processing, thereby compromising cell wall integrity, reducing virulence factor secretion, and enhancing host immune recognition of the pathogen.

How conserved is BST1 function across different Cryptococcus species and other pathogenic fungi?

BST1 function shows significant conservation across pathogenic fungi, though with species-specific adaptations that reflect evolutionary divergence and niche specialization:

In C. albicans, BST1 functions as an inositol deacylase for GPI-APs and is critical for cell wall anchorage, host invasion, and immune escape . The catalytic mechanism centers on a serine residue (S202), which aligns with known catalytic sites in other organisms - serine-236 in S. cerevisiae and serine-174 in human PGAP1 .

C. neoformans utilizes a SEC14-dependent pathway for secretion of phospholipase B1 (CnPlb1), which is essential for virulence and CNS dissemination . Interestingly, this pathway appears selective for certain virulence factors, as other factors like laccase 1 (Lac1) and capsular material are exported via different mechanisms . This selective trafficking suggests that even highly conserved processing pathways may show functional specialization across fungal species.

The evolutionary conservation of BST1 is further evidenced by:

  • Sequence homology: BST1 shows significant homology from yeasts to humans (PGAP1), indicating its ancient evolutionary origin and essential function

  • Catalytic mechanism: The serine-based catalytic activity appears conserved across species

  • Functional impact: BST1 deficiency consistently affects cell wall integrity and virulence across different fungal pathogens

  • Substrate specificity: The precise GPI-APs processed by BST1 vary between species based on their virulence strategies

  • Regulatory mechanisms: Control of BST1 expression and activity may differ across fungal species depending on their infection niches

  • Interaction partners: BST1 may cooperate with different sets of proteins across species, as suggested by the specialized secretion pathways in C. neoformans

These comparative aspects provide valuable insights for developing broad-spectrum antifungal strategies targeting conserved elements of BST1 function.

What can comparative studies between C. neoformans BST1 and C. albicans BST1 tell us about fungal pathogenesis mechanisms?

Comparative studies between C. neoformans BST1 and C. albicans BST1 offer profound insights into both conserved and divergent pathogenesis mechanisms, illuminating fundamental principles of fungal virulence:

  • Cell wall architecture and immune evasion:
    In C. albicans, BST1 deficiency leads to impaired cell wall anchorage of GPI-APs and subsequent unmasking of β-(1,3)-glucan, enhancing immune recognition . Comparative studies would reveal whether C. neoformans employs similar masking strategies or has evolved alternative mechanisms, potentially related to its distinctive capsule. The comparison could elucidate common principles of immune evasion across pathogenic fungi despite their different structural features.

  • Virulence factor deployment:
    C. albicans BST1 mutants show attenuated virulence and reduced organ colonization , while in C. neoformans, the SEC14-dependent pathway affects CnPlb1 secretion and subsequent virulence . Comparative analysis could reveal whether BST1 in C. neoformans similarly impacts virulence factor deployment, potentially through different mechanisms adapted to its unique ecological niche and infection strategy.

  • Host tissue tropism:
    C. neoformans shows strong neurotropism and CNS dissemination capabilities , while C. albicans more commonly affects multiple organs in systemic infections . Comparing the role of BST1 in these different infection patterns could reveal how GPI-AP processing contributes to tissue-specific virulence traits.

  • Evolutionary adaptation:
    Despite being distantly related fungal pathogens, both organisms require proper GPI-AP processing for virulence. Comparative genomic and functional studies of BST1 could identify how this conserved mechanism has been adapted through evolution to support different pathogenic lifestyles.

  • Therapeutic targeting potential:
    Observed differences in BST1 function between species could inform the development of either broad-spectrum antifungals (targeting conserved features) or species-specific therapies (exploiting unique aspects of each pathogen's BST1-dependent processes).

Methodologically, these comparative studies would benefit from:

  • Reciprocal complementation experiments (expressing C. albicans BST1 in C. neoformans BST1 mutants and vice versa)

  • Identification of the specific GPI-AP repertoires affected by BST1 in each species

  • Cross-species infection models comparing wild-type and BST1 mutants from both fungi

  • Structural studies identifying species-specific features of the BST1 enzyme

How might BST1 function be exploited for developing novel antifungal therapies against cryptococcal infections?

BST1 represents a promising target for novel antifungal development against cryptococcal infections through several strategic approaches:

  • Direct enzyme inhibition:
    Developing small molecule inhibitors that specifically target the catalytic activity of BST1, focusing on the conserved serine residue essential for inositol deacylation . Such inhibitors would disrupt proper GPI-AP processing, leading to:

    • Compromised cell wall integrity, as observed in BST1-deficient C. albicans

    • Enhanced immune recognition through unmasking of fungal PAMPs, particularly β-(1,3)-glucan

    • Reduced secretion of virulence factors similar to effects seen in SEC14 mutants

  • Combinatorial therapy approaches:
    BST1 inhibitors could potentially synergize with:

    • Existing antifungals targeting cell wall components (echinocandins) or ergosterol (azoles)

    • Inhibitors of complementary pathways like SEC14-dependent secretion

    • Immunotherapeutic approaches that leverage the enhanced immune recognition of BST1-compromised fungi

  • Specific virulence attenuation:
    Target the BST1-dependent processing of specific virulence factors, particularly those involved in:

    • CNS dissemination, a critical aspect of cryptococcal pathogenesis

    • Vomocytosis, which is reduced in strains with impaired CnPlb1 secretion

    • Immune modulation, like the eicosanoid production dependent on proper CnPlb1 function

  • Diagnostic-therapeutic combinations:
    Development of theranostic approaches that:

    • Detect BST1 activity or GPI-AP profiles as biomarkers of virulence

    • Simultaneously deliver targeted inhibitors to BST1-expressing cryptococcal cells

    • Monitor treatment efficacy through changes in GPI-AP presentation

Key considerations for therapeutic development include:

  • Selectivity: Designing inhibitors that target fungal BST1 while sparing the mammalian homolog PGAP1

  • BBB penetration: Ensuring sufficient central nervous system penetration to treat cryptococcal meningitis

  • Resistance management: Targeting highly conserved regions of BST1 to minimize resistance development

  • Formulation strategies: Developing delivery systems that can penetrate the cryptococcal capsule and cell wall

Experimental models for evaluating such therapeutics should include both in vitro assays of BST1 activity and in vivo assessment of CNS dissemination in appropriate animal models .

What novel experimental techniques could advance our understanding of BST1's role in Cryptococcus neoformans pathogenesis?

Several cutting-edge experimental techniques could significantly advance our understanding of BST1's role in C. neoformans pathogenesis:

  • Advanced imaging technologies:

    • Super-resolution microscopy (STORM, PALM) to visualize BST1 localization and trafficking in living cells at nanometer resolution

    • Correlative light and electron microscopy (CLEM) to examine BST1's relationship with cell wall structure and GPI-AP distribution

    • Intravital microscopy to track BST1-dependent processes during in vivo infection, particularly during CNS invasion

  • Omics-based approaches:

    • GPI-anchored proteomics: Comparing wild-type and BST1-deficient strains to identify the complete repertoire of BST1-dependent GPI-APs

    • Lipidomics focused on GPI anchor structural variations in the presence and absence of BST1 activity

    • Transcriptomics of host-pathogen interactions to identify BST1-dependent modulation of host responses

    • Single-cell RNA-seq to capture heterogeneity in BST1 expression and activity during infection

  • Genetic and molecular tools:

    • CRISPRi/CRISPRa systems for conditional regulation of BST1 expression

    • Split-GFP complementation assays to identify BST1 interaction partners in vivo

    • GPI anchor reporters with fluorescent tags to track BST1-dependent processing in real-time

    • Fungal optogenetics to control BST1 activity with light, allowing temporal precision in functional studies

  • Structural biology approaches:

    • Cryo-electron microscopy of BST1 in different functional states

    • AlphaFold2 and other AI-based structure prediction followed by validation

    • Hydrogen-deuterium exchange mass spectrometry to map conformational changes during catalysis

  • Advanced infection models:

    • Organ-on-chip systems incorporating blood-brain barrier components to study BST1's role in CNS invasion

    • Humanized mouse models to better recapitulate human-specific aspects of cryptococcal pathogenesis

    • Ex vivo brain slice cultures to study BST1-dependent CNS colonization mechanisms

  • Fungal-specific techniques:

    • Cell wall analysis using atomic force microscopy to quantify nanomechanical properties affected by BST1

    • Real-time vomocytosis assays coupling fluorescent cryptococcal strains with automated imaging to quantify the impact of BST1 on non-lytic escape

    • In vivo fate mapping of cryptococcal populations to track BST1-dependent dissemination patterns

Implementation of these techniques would provide unprecedented insights into BST1's multifaceted roles in cryptococcal pathogenesis, potentially revealing new aspects of GPI-AP processing in fungal virulence and host-pathogen interactions.

What are common challenges in purifying active recombinant BST1 and how can they be overcome?

Purifying active recombinant BST1 from C. neoformans presents several technical challenges, given its nature as a membrane-associated enzyme involved in GPI-anchor processing. Here are common challenges and their solutions:

  • Low expression levels:

    • Challenge: As a regulatory enzyme, BST1 may naturally express at low levels.

    • Solutions:

      • Optimize codon usage for the expression host

      • Use strong inducible promoters appropriate for the expression system

      • Consider fusion tags that enhance expression (MBP, SUMO, thioredoxin)

      • Test multiple expression strains in parallel (BL21(DE3), Rosetta, SHuffle for E. coli; different yeast strains)

      • Implement low-temperature induction protocols (16-20°C) to allow proper folding

  • Protein insolubility and aggregation:

    • Challenge: As a membrane-associated protein, BST1 contains hydrophobic regions prone to aggregation.

    • Solutions:

      • Systematic detergent screening (DDM, LMNG, GDN, FC-12) at various concentrations

      • Test solubilization with mild detergents or lipid nanodiscs

      • Design constructs removing transmembrane domains while preserving the catalytic domain

      • Add stabilizing agents (glycerol, specific lipids) to buffers

      • Consider refolding protocols from inclusion bodies if necessary

  • Loss of enzymatic activity:

    • Challenge: BST1 may lose catalytic function during purification.

    • Solutions:

      • Maintain reducing conditions throughout purification (DTT or TCEP)

      • Protect the catalytic serine residue with reversible inhibitors during purification

      • Minimize time between lysis and final storage

      • Test activity at each purification step to identify problematic conditions

      • Consider activity assays using synthetic substrates rather than natural GPI anchors

  • Post-translational modifications:

    • Challenge: BST1 may require specific modifications for activity.

    • Solutions:

      • Use eukaryotic expression systems (yeast, insect cells) rather than bacterial systems

      • If using E. coli, co-express with chaperones or foldases

      • Verify modification status using mass spectrometry

      • Test enzymatic activity with varying degrees of glycosylation

  • Assessing enzymatic activity:

    • Challenge: The natural substrate (GPI anchor) is complex and difficult to obtain in quantity.

    • Solutions:

      • Develop simplified substrate analogs for high-throughput activity assays

      • Use PI-PLC sensitivity of GPI-APs as an indirect readout for BST1 activity

      • Implement fluorescence-based assays with labeled GPI anchor precursors

      • Consider complementation assays in BST1-deficient yeast as functional verification

  • Protein stability during storage:

    • Challenge: Purified BST1 may rapidly lose activity during storage.

    • Solutions:

      • Test various buffer compositions (pH, salt concentration, additives)

      • Optimize cryoprotectants (glycerol, sucrose, trehalose)

      • Assess flash-freezing vs. slow cooling protocols

      • Consider lyophilization for long-term storage if appropriate

By systematically addressing these challenges, researchers can develop reliable protocols for obtaining functionally active recombinant BST1, enabling structural studies and inhibitor development efforts.

How can researchers address conflicting data between in vitro and in vivo studies of BST1 function?

Resolving discrepancies between in vitro and in vivo studies of BST1 function requires a systematic methodological approach that bridges laboratory and physiological contexts:

  • Validate experimental models and conditions:

    • Strain considerations: Ensure laboratory strains maintain relevant virulence properties by periodic passage through animal models. Conflicting results may emerge from attenuated laboratory strains versus clinical isolates.

    • Growth conditions: Standardize in vitro conditions to better mimic in vivo environments, including physiological pH, temperature, CO2 levels, and nutrition availability. Compare BST1 activity under standard laboratory conditions versus host-mimicking conditions.

    • Temporal factors: Account for differences in experimental timeframes. Short-term in vitro assays may not capture delayed effects observed in vivo over days or weeks.

  • Bridge the complexity gap:

    • Ex vivo systems: Implement intermediate complexity models like organ explants or blood-brain barrier models to bridge pure in vitro and in vivo studies.

    • 3D culture systems: Use fungal biofilms and organoid co-cultures to better represent spatial organization found in vivo.

    • Host factor supplementation: Add relevant host factors (serum proteins, immune components) to in vitro systems to better approximate in vivo conditions.

  • Refine analytical approaches:

    • Single-cell analysis: Apply techniques like single-cell RNA-seq or imaging mass cytometry to capture cell-to-cell variability that may explain conflicting population-level data.

    • In situ measurements: Develop methods to measure BST1 activity directly in infected tissues, using reporter systems or metabolic labeling.

    • Mathematical modeling: Develop models that integrate in vitro kinetic data with in vivo parameters to predict behavior across experimental contexts.

  • Address specific BST1-related considerations:

    • Substrate availability: Natural GPI-anchor substrates may differ between in vitro and in vivo conditions.

    • Redundancy mechanisms: Functional compensation by other enzymes may occur in vivo but not in simplified in vitro systems, similar to the redundancy observed between SEC14 homologues in C. neoformans .

    • Protein interactions: BST1 may interact with different partners in vivo versus in vitro, affecting its function and localization.

  • Experimental design strategies:

    • Parallel testing: Design experiments that simultaneously assess the same parameters in vitro and in vivo.

    • Staged complexity: Progressively increase system complexity from purified components to whole organisms, identifying where discrepancies emerge.

    • Cross-validation: Use multiple independent techniques to measure the same outcome across different experimental systems.

  • Case-specific approaches for BST1 function:

    • If in vitro assays show BST1 activity but in vivo phenotypes are subtle: Investigate potential compensatory mechanisms or redundant pathways, as observed with SEC14 homologues in C. neoformans .

    • If in vitro inhibition doesn't translate to in vivo efficacy: Examine pharmacokinetics, target accessibility, or potential biofilm protection mechanisms.

    • If BST1 deletion shows different phenotypes in vitro versus in vivo: Consider host factor interactions or stress responses specifically induced in the host environment.

By systematically addressing these considerations, researchers can resolve conflicts between in vitro and in vivo findings, developing a more cohesive understanding of BST1's role in cryptococcal pathogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.