Recombinant Cryptococcus neoformans var. neoformans serotype D Iron-sulfur clusters transporter ATM1, mitochondrial (ATM1)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant Cryptococcus neoformans var. neoformans serotype D Iron-Sulfur (Fe-S) clusters transporter ATM1, mitochondrial (ATM1) is a genetically engineered form of the mitochondrial ABC (ATP-binding cassette) transporter critical for Fe-S cluster biogenesis and iron homeostasis. ATM1 exports Fe-S cluster precursors from mitochondria to the cytosol, enabling the maturation of cytosolic and nuclear Fe-S proteins essential for cellular metabolism and pathogenicity .

Table 1: Key Biochemical Properties of ATM1

PropertyDescriptionSource
Molecular Weight~72 kDa (predicted for recombinant form)
ATPase ActivityStimulated by oxidized glutathione (GSSG) and [4Fe-4S] clusters
Substrate AffinityBinds 2Fe-2S4_4 complexes with electrostatic interactions at the TMD-NBD interface
Structural ConformationInward-facing open state for substrate binding; outward-facing closed state for cargo release

Fe-S Cluster Biogenesis and Iron Homeostasis

  • Cytosolic Fe-S Protein Maturation: ATM1 depletion reduces activity of cytosolic isopropylmalate dehydrogenase (Leu1) and sulfite reductase, confirming its role in cytosolic Fe-S protein assembly .

  • Heme Biosynthesis: ATM1-deficient strains exhibit diminished catalase activity, linking Fe-S export to heme metabolism .

  • Iron Regulation: ATM1 loss triggers iron starvation responses, including upregulation of iron uptake genes (CIG1, SIT1) .

Copper Stress Response

ATM1 expression is transcriptionally regulated by the copper-sensing transcription factor Cuf1. Under copper stress:

  • ATM1 mRNA and protein levels increase rapidly (within 15–90 minutes) .

  • ATM1 mitigates copper toxicity by maintaining cytosolic Fe-S protein integrity, critical for DNA repair and metabolic enzymes .

Table 2: Phenotypic Consequences of ATM1 Deletion in C. neoformans

PhenotypeWild-Typeatm1Δ MutantReconstituted StrainSource
Growth in YPD MediumNormalDoubling time ↑ (6.81 vs. 3.04 hrs)Restored
Non-fermentable Carbon UtilizationYesNo growth on ethanol/acetateRestored
Virulence in Murine ModelLethalAvirulentRestored
Cu ToleranceHighSevere growth defectPartially restored

Comparative Analysis with Homologs

ATM1 functional conservation is evident across eukaryotes:

  • Yeast Complementation: C. neoformans ATM1 partially rescues growth defects in Saccharomyces cerevisiae atm1Δ mutants but fails to restore full respiratory function .

  • Human ABCB7: Mutations in ABCB7 cause X-linked sideroblastic anemia, mirroring mitochondrial iron overload in ATM1-deficient fungi .

  • Apicomplexan Parasites: Toxoplasma gondii ATM1 is essential for cytosolic Fe-S protein assembly, highlighting evolutionary conservation .

Research Applications of Recombinant ATM1

Recombinant ATM1 is pivotal for:

  1. Mechanistic Studies: Elucidating Fe-S cluster export via structural snapshots (e.g., inward/outward conformational states) .

  2. Drug Development: Targeting ATM1 in C. neoformans could impair virulence without affecting human homologs .

  3. Biochemical Assays: ATPase activity measurements under varying glutathione/Fe-S conditions .

Unresolved Questions and Future Directions

  • Substrate Specificity: Whether ATM1 transports 2Fe-2S4_4, polysulfides, or other sulfur intermediates remains debated .

  • Regulatory Networks: How ATM1 interacts with mitochondrial ISC machinery (e.g., scaffold proteins) needs further study .

  • Therapeutic Potential: Small-molecule inhibitors of ATM1 could synergize with copper-based antifungals .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributor for specific delivery information.
Note: All protein shipments include standard blue ice packs. If dry ice shipment is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
ATM1; CNBH1800; Iron-sulfur clusters transporter ATM1, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
56-734
Protein Length
Full Length of Mature Protein
Species
Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) (Filobasidiella neoformans)
Target Names
ATM1
Target Protein Sequence
QLPRHGSHFQSLAFFSTSRRRQTPPPPSPPTTSQSPTVPSKASTTPPTSLNTSKPVATES QDKTDWSIIAKLAGNIWPKNNPNVKFRVIGALTLLVAGKVLNVQVPFFFKTIVDSLNVPI TESTTVWVLAGASIAGYGAARVLTTLFGELRNAVFASVAQNAIRKVARETFEHLLNMDMK FHLERQTGGLTRAIDRGTKGISFILSSIVFHVIPTALEISMVCGILSWKFGWDFAAVTAI TMLLYTWFTIKTTAWRTTFRKQANAADNKGATVAVDSLINYEAVKSFNNEKYEVAQYDTT LKAYEKASVKIATSLAALNSGQNFIFSSALTMMMLLGAQGIVKGTMTVGDLVLVNQLVFQ LSLPLNFLGTVYRELRQSLIDMDVMFNLQSLDSATKDSPTAKPLHLKGGEIEFRNVAFAY HPERPIFRDLSFKIPAGQKVAIVGPSGCGKSTVFRLLFRFYDSSSGQILIDGQDIKTVTL DSLRRSIGVVPQDTPLFHADILHNIRYGNLEATDEQVYEAARKAHVEGTIQRLPEKYATK VGERGLMISGGEKQRLAVARVLLKDPPVLFFDEATSALDVYTETELMRNINSILTGQGKT SVFIAHRLRTISDADLIIVLQDGYVAEQGTHEQLLAMPGGVYHGLWQAQLTESTQPTEEE IERQREELEIVDEKKKQQT
Uniprot No.

Target Background

Function
ATM1 (Iron-sulfur clusters transporter ATM1, mitochondrial) plays a crucial role in the generation of cytoplasmic iron-sulfur proteins by mediating the ATP-dependent export of Fe/S cluster precursors synthesized by NFS1 and other mitochondrial proteins. It hydrolyzes ATP and binds glutathione, potentially functioning by transporting a glutathione-conjugated iron-sulfur compound.
Database Links
Protein Families
ABC transporter superfamily, ABCB family, Heavy Metal importer (TC 3.A.1.210) subfamily
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the basic function of ATM1 in Cryptococcus neoformans var. neoformans serotype D?

ATM1 in C. neoformans is a mitochondrial ABC transporter responsible for exporting the precursor of iron-sulfur clusters (ISCs) from mitochondria to the cytosol. This exported precursor is essential for the assembly of cytosolic and nuclear iron-sulfur cluster proteins. Studies have demonstrated that ATM1 plays a critical role in iron metabolism and is required for proper cellular functions, including respiration and amino acid biosynthesis. Deletion of the ATM1 gene significantly affects mitochondrial functioning, suggesting its fundamental importance in cellular physiology .

When investigating ATM1 function, researchers should consider its dual role in both ISC biosynthesis in the cytoplasm and heme metabolism. Experimental evidence shows diminished activity of cytosolic ISC-containing proteins (such as Leu1) and heme-containing proteins (like catalase) in ATM1 deletion mutants, confirming its multifaceted role in C. neoformans metabolism .

How does ATM1 in C. neoformans serotype D compare structurally and functionally with homologs in other fungi?

Experimental approaches to address this question typically involve:

  • Sequence alignment and phylogenetic analysis

  • Heterologous expression studies

  • Complementation assays in ATM1-deficient strains of model organisms

  • Localization studies using GFP-fusion proteins

For instance, fluorescence microscopy and Western blot analysis using mitochondrial fractions have confirmed that the C. neoformans ATM1 protein localizes to mitochondria, similar to its S. cerevisiae counterpart .

What are the most effective methods for generating recombinant ATM1 from C. neoformans var. neoformans serotype D?

When generating recombinant ATM1 from C. neoformans var. neoformans serotype D, researchers should consider several methodological approaches:

  • Gene cloning and expression systems:

    • Identify the full-length ATM1 coding sequence from C. neoformans var. neoformans serotype D genomic DNA

    • Design primers that include appropriate restriction sites for insertion into expression vectors

    • Consider using S. cerevisiae expression systems for fungal protein production, as evidenced by successful complementation experiments

  • Protein purification strategies:

    • Include a purification tag (His, GST, or FLAG) that won't interfere with protein function

    • Employ membrane protein solubilization techniques appropriate for ABC transporters

    • Use affinity chromatography followed by size exclusion chromatography

  • Functional verification:

    • Complementation assays in S. cerevisiae ATM1 mutants (as demonstrated in the literature )

    • In vitro transport assays with reconstituted protein in liposomes

    • Binding assays with potential substrate molecules

The literature has demonstrated successful expression of C. neoformans ATM1 in S. cerevisiae using episomal vectors such as Yep352Gap-II, which can serve as a starting point for recombinant protein production .

What are the most reliable phenotypic assays to confirm ATM1 deletion or mutation in C. neoformans?

Several reliable phenotypic assays can confirm ATM1 deletion or mutation in C. neoformans:

  • Growth on different carbon sources:

    • ATM1 mutants show reduced growth in glucose-containing medium (YPD) with approximately double the doubling time compared to wild-type strains

    • ATM1 mutants fail to grow on non-fermentable carbon sources such as ethanol and acetate, indicating respiratory defects

  • Response to altered oxygen levels:

    • ATM1 mutants show restored growth under reduced oxygen conditions, confirming the involvement of ATM1 in mitochondrial respiratory functions

  • Sensitivity to respiratory inhibitors:

    • Testing sensitivity to specific inhibitors of mitochondrial respiratory complexes:

      • Diphenyleneiodonium (DPI) and rotenone (complex I)

      • Malonic acid (complex II)

      • Antimycin A (complex III)

      • Potassium cyanide (complex IV)

      • Salicylhydroxamic acid (SHAM) (alternative oxidase)

    • ATM1 mutants show increased tolerance to DPI and rotenone, suggesting altered complex I activity

  • Enzymatic activity assays:

    • Measure activity of cytosolic ISC-containing enzymes (e.g., Leu1)

    • Assess heme-containing protein function (e.g., catalase)

    • Both activities are diminished in ATM1 mutants

Phenotypic TestWild-type ResponseATM1 Mutant ResponseInterpretation
YPD growth (glucose)Normal (3.04h doubling)Reduced (6.81h doubling)ATM1 required for optimal growth
Non-fermentable carbon growthGrowth observedNo growthATM1 essential for respiratory metabolism
Low oxygen conditionsNormal growthImproved growth compared to aerobicConfirms respiratory defect
DPI/Rotenone sensitivityNormal sensitivityIncreased toleranceAltered complex I activity
Leu1/Catalase activityNormal activityDiminished activityDefective ISC/heme metabolism

How does ATM1 coordinate with other proteins in the iron-sulfur cluster biogenesis pathway?

ATM1 functions as a critical component in the iron-sulfur cluster (ISC) biogenesis pathway, coordinating with multiple proteins across cellular compartments:

  • Mitochondrial ISC assembly machinery:

    • ATM1 acts downstream of the mitochondrial ISC assembly system

    • It exports an unknown precursor (possibly glutathione-complexed [2Fe-2S] clusters) produced by the mitochondrial ISC machinery

  • Cytosolic Iron-Sulfur Protein Assembly (CIA) machinery:

    • The exported precursor is utilized by the CIA machinery for assembling cytosolic and nuclear ISC-containing proteins

    • ATM1 deletion affects the activity of cytosolic ISC proteins like Leu1, demonstrating this functional relationship

  • Coordination with iron homeostasis systems:

    • ATM1 function affects cellular iron distribution

    • The protein likely plays a role in signaling between mitochondria and the cytosol regarding iron status

To study these interactions experimentally, researchers can:

  • Perform co-immunoprecipitation assays to identify direct protein interactions

  • Use genetic approaches to create double mutants and observe synthetic phenotypes

  • Employ metabolomic analysis to track changes in iron-containing metabolites

  • Apply systems biology approaches to model the entire ISC biogenesis network

The research on C. neoformans has identified key ISC-containing proteins like homoaconitase (Lys4) and isopropylmalate dehydrogenase (Leu1), which function in mitochondria and cytosol respectively, providing experimental targets for studying ATM1's role in ISC trafficking .

What experimental approaches can detect alterations in iron distribution in ATM1 mutants?

Several experimental approaches can effectively detect alterations in iron distribution in ATM1 mutants:

  • Subcellular fractionation and iron quantification:

    • Isolate mitochondria, cytosol, and other cellular compartments

    • Measure iron content in each fraction using atomic absorption spectroscopy or inductively coupled plasma mass spectrometry (ICP-MS)

    • Compare iron distribution between wild-type and ATM1 mutant strains

  • Iron-responsive reporter systems:

    • Construct reporter genes under the control of iron-responsive promoters

    • Monitor activity in different cellular compartments

    • Compare responses between wild-type and ATM1 mutant strains

  • Activity assays for iron-dependent enzymes:

    • Measure the activity of compartment-specific iron-dependent enzymes:

      • Mitochondrial enzymes: aconitase, succinate dehydrogenase

      • Cytosolic enzymes: Leu1 (as demonstrated in the literature )

      • Catalase activity (for heme-dependent functions)

  • Iron chelation sensitivity:

    • Test growth in the presence of iron chelators (e.g., bathophenanthroline disulfonate for extracellular iron, dipyridyl for intracellular iron)

    • Compare sensitivity profiles between wild-type and ATM1 mutant strains

  • Microscopy techniques:

    • Use iron-specific fluorescent probes

    • Apply techniques like Perls' Prussian blue staining

    • Employ electron microscopy with iron detection methods

Research on C. neoformans ATM1 has already demonstrated that deletion mutants show diminished activity of the cytosolic ISC-containing protein Leu1 and the heme-containing protein catalase, providing evidence of altered iron distribution and utilization .

What is the evidence that ATM1 contributes to virulence in C. neoformans var. neoformans serotype D?

Strong evidence supports the crucial role of ATM1 in C. neoformans virulence:

  • In vivo virulence studies:

    • ATM1 deletion mutants are avirulent in murine models of cryptococcosis

    • This complete loss of virulence directly links ATM1 function to pathogenesis

  • Mechanistic basis for virulence contribution:

    • ATM1 mutants show defects in mitochondrial respiration

    • Iron metabolism disruption affects multiple virulence factors

    • ISC-containing proteins like Leu1 and heme-containing proteins like catalase show diminished activity in ATM1 mutants

  • Relationship to known virulence determinants:

    • Iron homeostasis is a well-established virulence factor in C. neoformans

    • Previous studies identified ISC-containing proteins Lys4 and Leu1 as influencing virulence

    • ATM1 acts upstream of these proteins in the iron utilization pathway

Experimental approaches to further investigate ATM1's role in virulence could include:

  • Transcriptomic analysis comparing wild-type and ATM1 mutants during infection

  • Proteomics to identify virulence-associated proteins affected by ATM1 deletion

  • Conditional mutants to determine if ATM1 is required during specific stages of infection

  • Host-pathogen interaction studies examining immune response to ATM1 mutants

These findings highlight the potential of ATM1 as a target for antifungal drug development, given its essential role in virulence .

How might ATM1 function differ between serotypes of C. neoformans and what implications does this have for pathogenesis?

The function of ATM1 may vary between C. neoformans serotypes (A, D, and AD hybrids), with significant implications for pathogenesis:

  • Genetic differences between serotypes:

    • Serotypes A and D show substantial genomic differences, suggesting possible functional variations in proteins like ATM1

    • Population structure analysis indicates different routes of multiplication between serotypes (clonal expansion for serotype A versus recombination events for serotype D)

  • Potential functional differences:

    • Based on observed differences in virulence between serotypes

    • Variation in mitochondrial function and iron metabolism could contribute to these differences

    • The partial complementation of S. cerevisiae ATM1 by C. neoformans ATM1 suggests serotype-specific functional adaptations may exist

  • Clinical implications:

    • Infections with AD hybrids show better prognosis compared to serotype A or D infections, at least in France

    • This clinical difference might relate to differences in iron metabolism and utilization

  • Experimental approaches to investigate serotype differences:

    • Comparative genomics of ATM1 sequences across serotypes

    • Heterologous expression studies swapping ATM1 between serotypes

    • Phenotypic analysis of hybrid strains with mixed ATM1 alleles

    • Virulence studies comparing ATM1 function across serotypes

Serotype CharacteristicSerotype ASerotype DAD Hybrid
Multiplication strategyPrimarily clonal expansionRecombination eventsMixed
Number of sequence types (STs)1944Variable
Gene diversity (H)0.860.95Variable
Average alleles per locus (N)5.5711.57Variable
Clinical prognosisVariableVariableBetter in some studies

This table is derived from data in search result , showing genetic diversity metrics that may influence ATM1 function across serotypes.

What are the key considerations for generating and verifying ATM1 mutations in C. neoformans var. neoformans serotype D?

When generating and verifying ATM1 mutations in C. neoformans var. neoformans serotype D, researchers should consider several methodological approaches:

  • Mutation strategy selection:

    • Complete gene deletion (knockout) using biolistic transformation with gene-specific knock-out cassettes, as demonstrated in the literature

    • Site-directed mutagenesis for studying specific functional domains

    • Conditional expression systems for essential genes

    • CRISPR-Cas9 approaches for precise genome editing

  • Strain verification methods:

    • PCR confirmation of correct insertion/deletion

    • Southern blot analysis to verify single integration

    • Sequencing to confirm the absence of secondary mutations

    • qRT-PCR to verify gene expression changes

  • Functional verification approaches:

    • Growth phenotype analysis on different carbon sources

    • Respiratory function assessment

    • Enzymatic activity measurements (Leu1, catalase)

    • Complementation with wild-type gene to restore phenotype

  • Control strains generation:

    • Wild-type parental strain

    • Reconstituted strain (ATM1 gene reintroduced at the original locus), as used in published studies

    • Heterozygous strains when applicable

    • Strains with complementation by orthologous genes

  • Special considerations for C. neoformans:

    • Potential mixed infections in clinical isolates may complicate strain characterization

    • Serotype-specific genetic tools may be necessary

    • Ploidy variations must be accounted for (haploid vs. diploid strains)

The literature describes successful generation of ATM1 mutants in C. neoformans using biolistic transformation, followed by verification through phenotypic assays and complementation studies, providing a methodological framework for researchers .

How can researchers address potential pleiotropic effects when studying ATM1 function?

Addressing pleiotropic effects is critical when studying ATM1 function, as its role in iron-sulfur cluster transport affects multiple cellular processes:

  • Experimental approaches to distinguish direct from indirect effects:

    • Domain-specific mutations to separate different functions

    • Temporal analysis using inducible systems

    • Suppressor screens to identify genetic interactions

    • Metabolomic profiling to map affected pathways comprehensively

  • Controls to account for growth defects:

    • Normalize experimental measurements to cell number or protein content

    • Use time-course experiments rather than endpoint measurements

    • Compare to other respiratory-deficient mutants as controls

    • Perform experiments under conditions that minimize growth differences (e.g., reduced oxygen)

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Apply network analysis to distinguish primary from secondary effects

    • Use computational modeling to predict system-wide impacts

  • Complementation strategies:

    • Express specific functions of ATM1 separately

    • Utilize heterologous systems for functional analysis

    • Perform cross-species complementation (as demonstrated with S. cerevisiae)

    • Introduce mutated versions with altered substrate specificity

  • Assessing physiological relevance:

    • Validate findings under infection-relevant conditions

    • Correlate molecular findings with virulence phenotypes

    • Consider host-pathogen interaction contexts

The literature demonstrates several of these approaches, including the use of respiratory inhibitors to probe specific aspects of mitochondrial function in ATM1 mutants and complementation studies to verify functional conservation .

What are the current hypotheses regarding the precise substrate exported by ATM1 in C. neoformans?

Several hypotheses exist regarding the precise substrate exported by ATM1 in C. neoformans, though definitive identification remains an active area of research:

  • Glutathione-complexed [2Fe-2S] clusters:

    • Based on studies in S. cerevisiae suggesting ATM1 transports glutathione-coordinated iron-sulfur clusters

    • This hypothesis is supported by diminished activity of cytosolic ISC proteins in ATM1 mutants

  • Alternative sulfur-containing compounds:

    • X-S compounds that might serve as precursors for cytosolic ISC assembly

    • Possible involvement in sulfur trafficking beyond iron metabolism

  • Signaling molecules:

    • Potential role in exporting molecules that signal mitochondrial iron status to the cytosol

    • May function in retrograde signaling pathways

  • Multiple substrates:

    • ATM1 might export several related compounds

    • Explains the diverse phenotypes observed in ATM1 mutants

Experimental approaches to identify the substrate include:

  • In vitro transport assays with purified protein

  • Metabolomic comparison of wild-type and ATM1 mutant mitochondria

  • Structural studies to characterize the substrate-binding pocket

  • Genetic screens for suppressors of ATM1 deletion phenotypes

The diminished activity of both ISC-containing proteins (Leu1) and heme-containing proteins (catalase) in ATM1 mutants suggests its substrate may be involved in both pathways, providing clues for substrate identification .

What advanced techniques can be used to study the structure-function relationship of ATM1 in C. neoformans?

Advanced techniques for studying ATM1 structure-function relationships include:

  • Structural biology approaches:

    • X-ray crystallography of purified ATM1 protein

    • Cryo-electron microscopy for membrane-embedded visualization

    • NMR spectroscopy for dynamic studies

    • Molecular dynamics simulations based on homology models from related ABC transporters

  • Functional domain mapping:

    • Systematic mutagenesis of conserved residues

    • Domain swapping with homologs from other species

    • Chimeric proteins with other ABC transporters

    • Hydrogen-deuterium exchange mass spectrometry to identify substrate-binding regions

  • Advanced genetic approaches:

    • CRISPR-Cas9 for precise genome editing to create specific mutations

    • Suppressor screens to identify functional interactions

    • Synthetic genetic array analysis to map genetic networks

    • Deep mutational scanning to comprehensively assess functional residues

  • Real-time monitoring techniques:

    • Development of fluorescent sensors for ATM1 activity

    • Single-molecule tracking in living cells

    • FRET-based assays to detect substrate binding and transport

    • Live-cell imaging during infection processes

  • Integration with systems biology:

    • Multi-omics approaches to understand global impacts of ATM1 mutations

    • Network analysis to position ATM1 in iron homeostasis pathways

    • Mathematical modeling of iron-sulfur cluster trafficking

    • Comparative analysis across fungal species to identify conserved mechanisms

These approaches can build upon existing knowledge of ATM1 localization to mitochondria and its partial functional complementation of S. cerevisiae ATM1, advancing our understanding of this critical transporter's mechanism .

How might targeting ATM1 inform development of novel antifungal strategies?

Targeting ATM1 presents a promising avenue for antifungal development based on several key factors:

  • Essential role in virulence:

    • ATM1 deletion renders C. neoformans avirulent in murine models

    • This direct link to pathogenesis makes it an attractive drug target

  • Target validation considerations:

    • Genetic evidence from knockout studies confirms ATM1's importance

    • Phenotypic assays exist to monitor ATM1 function, facilitating drug screening

    • The protein's role in both mitochondrial function and iron metabolism offers multiple intervention points

  • Drug development approaches:

    • Structure-based drug design targeting the ATP-binding domain

    • Substrate analog development to competitively inhibit transport

    • Allosteric inhibitors affecting conformational changes

    • Screening of natural product libraries for inhibitors

  • Selectivity considerations:

    • Comparative analysis of fungal and human ATM1 homologs to identify differences

    • Focus on regions with low sequence conservation but functional importance

    • Target unique regulatory mechanisms in fungal ATM1

  • Experimental strategies for inhibitor discovery:

    • Development of high-throughput assays based on ATM1 function

    • Phenotypic screens using growth on non-fermentable carbon sources

    • ATP hydrolysis assays with purified protein

    • Transport assays in reconstituted systems

The complete avirulence of ATM1 mutants, combined with the protein's fundamental role in iron metabolism, makes it a particularly attractive target for novel antifungal strategies .

What mechanisms might contribute to potential resistance against ATM1-targeting antifungals?

Understanding potential resistance mechanisms is crucial when developing ATM1-targeting antifungals:

  • Target modification mechanisms:

    • Point mutations in ATM1 that maintain function but prevent inhibitor binding

    • Altered expression levels to overcome inhibition through increased protein production

    • Post-translational modifications affecting inhibitor interaction

  • Bypass mechanisms:

    • Upregulation of alternative iron transport systems

    • Metabolic adaptations to reduce dependence on cytosolic ISC proteins

    • Altered mitochondrial function to circumvent ATM1 requirements

  • Drug-specific resistance mechanisms:

    • Enhanced efflux through multidrug resistance transporters

    • Enzymatic modification of inhibitors

    • Sequestration of drugs away from the target site

  • Genetic plasticity considerations:

    • C. neoformans serotype D shows evidence of recombination events that could accelerate adaptation

    • Mixed infections with multiple genotypes could facilitate resistance development

    • The different multiplication strategies between serotypes may influence resistance emergence rates

  • Experimental approaches to study resistance:

    • In vitro evolution experiments under drug pressure

    • Whole-genome sequencing of resistant isolates

    • Heterologous expression of mutated ATM1 variants

    • Structure-activity relationship studies with modified inhibitors

The genomic differences between C. neoformans serotypes and their distinct reproductive strategies may influence resistance development patterns, requiring serotype-specific consideration in drug development .

What are the most critical unanswered questions regarding ATM1 function in C. neoformans?

Despite significant progress in understanding ATM1 in C. neoformans, several critical questions remain unanswered:

  • Substrate specificity:

    • What is the precise molecular identity of the substrate(s) transported by ATM1?

    • How does substrate specificity compare between C. neoformans and other fungi?

    • Are there additional, unidentified substrates beyond ISC precursors?

  • Regulatory mechanisms:

    • How is ATM1 expression and activity regulated in response to iron availability?

    • What signaling pathways control ATM1 function during infection?

    • How do environmental factors during infection affect ATM1 activity?

  • Structural determinants of function:

    • What structural features determine substrate specificity?

    • How do conformational changes couple ATP hydrolysis to substrate transport?

    • Which residues are essential for function versus those that modulate activity?

  • Serotype-specific considerations:

    • How does ATM1 function vary between C. neoformans serotypes?

    • Does this variation contribute to differences in virulence between serotypes?

    • How has evolutionary pressure shaped ATM1 function in different lineages?

  • Host-pathogen interface:

    • How does host iron sequestration affect ATM1 function during infection?

    • Does ATM1 activity influence host immune response?

    • Can ATM1 function be targeted by host defense mechanisms?

Addressing these questions will require integration of advanced structural biology, genetics, biochemistry, and infection models to fully elucidate the role of this critical transporter in C. neoformans biology and pathogenesis.

What emerging technologies might accelerate research on ATM1 and related iron-sulfur cluster transporters?

Several emerging technologies show promise for accelerating research on ATM1 and related iron-sulfur cluster transporters:

  • Advanced structural biology methods:

    • Cryo-electron microscopy for membrane protein structures at near-atomic resolution

    • Integrative structural biology combining multiple experimental approaches

    • Time-resolved structural studies to capture transport cycle intermediates

    • AlphaFold and related AI-based structure prediction tools for comparative modeling

  • Novel genetic tools:

    • CRISPR-Cas9 systems optimized for C. neoformans

    • Base editing for precise single nucleotide modifications

    • CRISPRi/CRISPRa for conditional expression studies

    • Synthetic genomics approaches for wholesale pathway engineering

  • Single-cell technologies:

    • Single-cell transcriptomics to identify cell-to-cell variation in ATM1 expression

    • Single-cell proteomics to track protein abundance and modifications

    • Microfluidic approaches for single-cell phenotyping

    • Live-cell imaging with enhanced resolution

  • Systems biology integration:

    • Multi-omics approaches with enhanced computational integration

    • Machine learning for pattern recognition in complex datasets

    • Network modeling of iron homeostasis pathways

    • Predictive models of drug-target interactions

  • Translational technologies:

    • High-throughput screening platforms for inhibitor discovery

    • Organ-on-chip models for infection studies

    • In silico drug design targeting ABC transporters

    • Nanobody development for inhibiting specific conformational states

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.