Recombinant Cryptococcus neoformans var. neoformans serotype D Mitochondrial import inner membrane translocase subunit TIM22 (TIM22)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please specify it in your order; we will prioritize its development.
Synonyms
TIM22; CNBC4640; Mitochondrial import inner membrane translocase subunit TIM22
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-187
Protein Length
full length protein
Species
Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) (Filobasidiella neoformans)
Target Names
TIM22
Target Protein Sequence
MSIPLPSAMPLLPPIYLPGQEPLPAGTSDWERQEMQTALKYQRYMGMVMESCPLKVTIAG VGGLAIGGFFSLMSATFAYEDPLSRASNKLTTTRAQTMFVFKEMGRNMWSSGRGFAKVGM VYSGVECCIEGYRAKNDIYNGVSAGFLTGAILARNAGPTAMLGGGVAFAAFSGAIDWWLR SAPADEI
Uniprot No.

Target Background

Function

Recombinant Cryptococcus neoformans var. neoformans serotype D Mitochondrial Import Inner Membrane Translocase Subunit TIM22 (TIM22) is an essential core component of the TIM22 complex. This complex facilitates the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. Within the TIM22 complex, TIM22 functions as a voltage-activated and signal-gated channel, forming a twin-pore translocase that utilizes the membrane potential as the driving force in two voltage-dependent steps.

Database Links
Protein Families
Tim17/Tim22/Tim23 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the structural organization of TIM22 in Cryptococcus neoformans var. neoformans serotype D?

TIM22 in Cryptococcus neoformans var. neoformans serotype D is a 187-amino acid protein that functions as the core channel-forming component of the TIM22 complex in the mitochondrial inner membrane. The protein contains four transmembrane helices that form a partial pore open to the lipid bilayer. According to structural analysis, TIM22 proteins typically contain two helices (α1 and α2) in the intermembrane space connected by an extended loop, followed by four transmembrane segments (TM1-4) . In fungal species including Cryptococcus, TIM22 contains highly conserved cysteine residues that form an intramolecular disulfide bond critical for protein stability and function .

How does the TIM22 complex function in mitochondrial protein import?

The TIM22 complex functions as a specialized translocase responsible for importing multi-transmembrane domain proteins with internal targeting signals into the inner mitochondrial membrane. The import process follows these steps:

  • Precursor proteins are recognized by receptors on the translocase of the outer membrane (TOM complex)

  • After translocation through the TOM complex, precursor proteins bind to small TIM chaperone complexes in the intermembrane space

  • These chaperones maintain the precursor in an import-competent state by preventing aggregation

  • The chaperone-precursor complex docks with the TIM22 complex

  • TIM22 facilitates insertion of the hydrophobic carrier proteins into the inner membrane

This process is essential for importing metabolite carrier proteins and other polytopic membrane proteins into the mitochondrial inner membrane .

What expression systems are optimal for producing recombinant C. neoformans TIM22?

  • Bacterial expression systems: While E. coli is commonly used, optimizing codon usage for fungal proteins is essential to improve expression efficiency. Addition of N-terminal His-tags facilitates purification while maintaining protein functionality.

  • Yeast expression systems: For functional studies, Saccharomyces cerevisiae or Pichia pastoris may provide a more native-like environment for proper folding and disulfide bond formation, which is critical given the importance of disulfide bonds in TIM22 function .

  • Cell-free expression systems: These may be useful for producing difficult-to-express membrane proteins like TIM22, allowing for direct incorporation into liposomes or nanodiscs.

When expressing TIM22, researchers should pay particular attention to the preservation of disulfide bonds and proper membrane insertion for functional studies .

How can researchers assess the functionality of recombinant TIM22 in vitro?

Assessing the functionality of recombinant TIM22 requires specialized approaches focused on membrane protein activity. Recommended methodological strategies include:

  • Reconstitution into liposomes: Purified TIM22 can be incorporated into liposomes to assess channel activity through electrophysiological measurements.

  • Protein import assays: Using isolated mitochondria from TIM22-depleted cells complemented with recombinant TIM22 to measure restoration of import efficiency of known TIM22 substrates (e.g., carrier proteins).

  • Disulfide bond formation analysis: As demonstrated by Okamoto et al., analysis of disulfide bond formation is critical for TIM22 function. This can be assessed using non-reducing SDS-PAGE and thiol-trapping reagents like AMS (4-acetamido-4'-maleimidylstilbene-2,2'-disulfonic acid) .

  • Blue native-PAGE: To analyze complex formation, researchers should employ BN-PAGE after solubilization with digitonin to assess whether recombinant TIM22 can form the native ~300-kDa TIM22 complex .

  • Thermal stability assays: Since disulfide bond formation affects thermal stability, differential scanning fluorimetry can evaluate proper folding and stability of wild-type versus mutant TIM22 proteins .

What mutagenesis strategies can be employed to study TIM22 function in C. neoformans?

Based on structural and functional studies of TIM22 in other organisms, several mutagenesis approaches can be employed:

  • Cysteine mutants: Creating C→S mutations to disrupt disulfide bond formation. Research by Okamoto et al. demonstrated that mutations of conserved cysteine residues (C42S, C141S, and C42/141S) destabilize the TIM22 complex and impair its function .

  • Transmembrane domain mutations: Targeted substitutions within the four transmembrane domains to identify residues critical for channel formation and substrate recognition.

  • N-terminal domain modifications: Mutations in helices α1 and α2 that interact with the Tim9/10a/10b chaperone complex to understand docking mechanisms with chaperones .

  • CRISPR/Cas9 genome editing: For in vivo studies in C. neoformans, CRISPR-based approaches can generate conditional mutants, allowing the study of essential proteins like TIM22.

When designing mutagenesis experiments, researchers should consider the evolutionary conservation of residues across fungal species and compare with known functional data from model organisms like S. cerevisiae .

How does TIM22 from C. neoformans serotype D differ from TIM22 in other fungal species?

Comparative analysis of TIM22 across fungal species reveals both conserved features and unique aspects of C. neoformans serotype D TIM22:

  • Core structure conservation: The four-transmembrane domain architecture is conserved across fungi, including S. cerevisiae and C. neoformans.

  • Disulfide bonding pattern: The conserved cysteine residues that form intramolecular disulfide bonds are present in both pathogenic and non-pathogenic fungi, suggesting their evolutionary importance for protein stability .

  • Sequence divergence: Despite functional conservation, sequence identity between C. neoformans TIM22 and S. cerevisiae TIM22 is moderate, reflecting evolutionary divergence.

  • Complex composition: The TIM22 complex composition varies across species. While S. cerevisiae includes Tim18 and Tim54 as additional components, the exact composition of the C. neoformans TIM22 complex remains to be fully characterized .

These differences may influence substrate specificity and complex stability, potentially contributing to pathogen-specific mitochondrial functions.

How might TIM22 function relate to virulence in C. neoformans serotype D strains?

The potential relationship between TIM22 function and virulence in C. neoformans serotype D involves several mechanisms:

  • Metabolic adaptation: TIM22's role in importing carrier proteins is critical for mitochondrial metabolism. Since adaptation to host environments requires metabolic flexibility, TIM22 function may indirectly influence virulence through its impact on energy production and stress responses.

  • Stress tolerance: Proper mitochondrial function is essential for tolerating oxidative stress encountered during host immune response. TIM22-mediated import of key metabolite carriers influences mitochondrial integrity under stress conditions.

  • Serotype-specific virulence: Clinical data indicates differences in virulence between serotypes. Serotype D strains show different clinical presentations compared to serotype A and AD hybrid strains . These differences may partly relate to mitochondrial adaptations involving the TIM22 complex.

  • Host adaptation: Serotype D strains have shown distinct geographical and clinical distributions compared to serotype A strains, suggesting adaptation to specific environmental conditions that may involve mitochondrial proteins including TIM22 .

Research examining these connections would require functional studies comparing TIM22 activity between virulent and attenuated strains, potentially revealing novel targets for antifungal development.

Could TIM22 serve as a target for antifungal drug development against C. neoformans?

TIM22 presents several characteristics that make it a potential candidate for antifungal drug development:

  • Essential function: As a core component of the mitochondrial protein import machinery, TIM22 is likely essential for fungal viability. Research has shown that disruption of the disulfide bond in TIM22 compromises cell growth when carrier proteins are overexpressed .

  • Structural divergence from human ortholog: While the function is conserved, structural differences between fungal and human TIM22 might allow for selective targeting. The human TIM22 complex has additional components (e.g., AGK, Tim29) not present in fungi .

  • Accessibility: As an inner membrane protein, TIM22 would require drugs capable of penetrating both the cell wall and mitochondrial outer membrane, presenting a delivery challenge.

  • Potential inhibition strategies:

    • Disruption of disulfide bond formation

    • Interference with TIM22 complex assembly

    • Blockage of the channel pore

    • Disruption of interactions with small TIM chaperones

Experimental approaches could include high-throughput screens using reconstituted TIM22 in liposomes or yeast-based screens measuring growth inhibition upon TIM22 targeting.

How do AD hybrid strains of C. neoformans maintain functional TIM22 complexes with potentially different TIM22 alleles?

AD hybrid strains of Cryptococcus neoformans represent an intriguing model for studying the compatibility of different protein alleles in essential complexes like TIM22. These hybrids contain genetic material from both serotype A and D strains and are often diploid or aneuploid . The functional integration of potentially different TIM22 alleles raises several research questions:

  • Allelic expression patterns: AD hybrids may preferentially express one allele of TIM22 over another, potentially explaining the better clinical outcomes observed in patients infected with AD hybrid strains compared to serotype A or D strains .

  • Heteromeric complex formation: The TIM22 complex in AD hybrids might contain a mixture of serotype A and D components, potentially creating novel functional properties not present in either parent strain.

  • Complementation effects: Complementary strengths of each allele might contribute to enhanced fitness under stress conditions, possibly explaining observations that AD hybrid infections showed better response to treatment (more CSF sterilization) .

  • Evolutionary implications: The successful maintenance of functional TIM22 complexes in hybrids suggests evolutionary conservation of core interaction domains despite sequence divergence between serotypes.

Research approaches might include allele-specific expression analysis, protein interaction studies, and comparative functional assays between hybrid and non-hybrid strains.

What role does the disulfide bond in TIM22 play in pathogen adaptation to host environments?

The intramolecular disulfide bond in TIM22 appears critical for protein stability and function, suggesting potential roles in pathogen adaptation:

  • Redox sensing: The disulfide bond might serve as a redox sensor, allowing C. neoformans to modulate mitochondrial protein import in response to changing redox conditions within the host.

  • Thermal stability: Research has shown that disulfide bonds confer thermal stability to the TIM22 complex . This may be particularly important for pathogens that must adapt to fever responses in mammalian hosts.

  • Functional resilience: When carrier proteins are overexpressed, cells with disulfide-intact TIM22 show better growth compared to Cys→Ser mutants . This suggests that the disulfide bond provides functional resilience under conditions of high metabolic demand, potentially during infection.

  • Evolutionary conservation: The conservation of these cysteine residues across fungal species suggests a fundamental role in maintaining TIM22 function under variable environmental conditions.

Experimental approaches might include creating C. neoformans strains with mutations in the cysteine residues of TIM22 and assessing their virulence and survival under host-mimicking conditions, including oxidative stress, elevated temperature, and nutrient limitation.

How might cryo-EM structural studies of the C. neoformans TIM22 complex advance our understanding of fungal mitochondrial import?

Recent advances in cryo-electron microscopy (cryo-EM) have revolutionized structural biology of membrane protein complexes. Application of these techniques to the C. neoformans TIM22 complex would provide several scientific benefits:

Methodological approaches would include recombinant expression and purification of the complete TIM22 complex, potentially using fungal expression systems to maintain native interactions, followed by single-particle cryo-EM and computational structure determination.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.