Recombinant Cryptococcus neoformans var. neoformans serotype D Mitochondrial import inner membrane translocase subunit TIM54 (TIM54)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us; we will prioritize development to meet your specifications.
Synonyms
TIM54; CNL03940; Mitochondrial import inner membrane translocase subunit TIM54
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-458
Protein Length
full length protein
Species
Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) (Filobasidiella neoformans)
Target Names
TIM54
Target Protein Sequence
MADLTPGARKPAPAELTGFRSALAHTGIPHGVLLWKPRLPSRNWLVFWSVSLSLSYAYYY DRAECKRIKQEVVERVEKYGREPMPGGSLGEPRRVVVWAGRWGGDDDADRAGRYFRKYVK PYLVAAGIDYTLPSVPLHGSITRQLHAAILLQRRQALGLAPTATPLSLPGVLDPAEAKRR EVESGVVVVGRASLKEYLEGLRRGWECGVDEWAWETEVEKTLAGDGVFESVESPVEPAVE TAETVVEPTADAVPKSNFGFLARPAPVTPGAPAIPAHLHTPPSPLPPTPPLLLLPFTNHL GFLQLPYMILDFFNERAKVRQGAQSALALIEGPTRDMHREDAEHWEEKSESWYNKTARQL PERLQKSRTEYYEAIKSRIDLARAYENGDREMTEEEKKANKVERIQDIQAERLKKELRWK GSEEGWEIVKPETPATWRDRWEGWLKVYQVPEDAQKGL
Uniprot No.

Target Background

Function

Recombinant Cryptococcus neoformans var. neoformans serotype D Mitochondrial import inner membrane translocase subunit TIM54 (TIM54): An essential component of the TIM22 complex, this protein facilitates the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. The TIM22 complex functions as a twin-pore translocase, utilizing the membrane potential as its driving force.

Database Links

KEGG: cne:CNL03940

STRING: 214684.XP_567952.1

UniGene: Fne.858

Protein Families
TIM54 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

How does TIM54 function differ in Cryptococcus neoformans compared to other fungal pathogens?

While TIM54 shares fundamental mitochondrial protein import functions across fungal species, C. neoformans TIM54 exhibits unique characteristics that may contribute to its pathogenic adaptability. Unlike Saccharomyces cerevisiae where TIM54 has been extensively studied, the C. neoformans ortholog likely has evolved specific features to support pathogenesis.

Research suggests that in C. neoformans, mitochondrial function is intimately linked to virulence factors, including the ability to form titan cells and resist host immune responses . The mitochondrial adaptations in C. neoformans, potentially involving TIM54, may allow the pathogen to withstand oxidative stress encountered during host infection and contribute to morphological transitions that enhance virulence.

What are the optimal conditions for expressing recombinant C. neoformans TIM54 protein?

For optimal expression of recombinant C. neoformans TIM54 protein, the following methodology has proven effective:

  • Expression System: E. coli is the recommended heterologous expression system .

  • Tagging Strategy: N-terminal His-tagging provides good results for purification while maintaining protein functionality .

  • Expression Vector: Vectors containing strong inducible promoters such as T7 are preferable for membrane protein expression.

  • Induction Parameters: Optimize IPTG concentration (typically 0.1-1.0 mM) and induction temperature (often lowered to 16-25°C for membrane proteins to improve folding).

  • Growth Media: Enriched media such as Terrific Broth may improve yield compared to standard LB media.

What purification and storage protocols ensure optimal activity of recombinant TIM54?

Purification and storage of recombinant TIM54 require careful handling to maintain protein integrity:

  • Purification Protocol:

    • Immobilized metal affinity chromatography (IMAC) using the His-tag

    • Consider detergent selection carefully for membrane protein solubilization

    • Secondary purification step (e.g., size exclusion chromatography) for higher purity

  • Storage Recommendations:

    • Store at -20°C/-80°C upon receipt

    • Aliquot the protein to avoid repeated freeze-thaw cycles

    • Use Tris/PBS-based buffer with 6% trehalose at pH 8.0

    • For reconstitution, use deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Addition of 5-50% glycerol is recommended (50% final concentration is standard)

  • Stability Considerations:

    • Working aliquots can be stored at 4°C for up to one week

    • Avoid repeated freeze-thaw cycles as they significantly reduce protein activity

How can researchers verify the functional integrity of recombinant TIM54?

Verification of TIM54 functional integrity can be accomplished through several complementary approaches:

  • Structural Assessment:

    • SDS-PAGE to confirm correct molecular weight and purity (>90% purity is desirable)

    • Circular dichroism (CD) spectroscopy to assess secondary structure elements

    • Limited proteolysis to evaluate proper folding

  • Functional Assays:

    • Reconstitution into liposomes to test membrane integration

    • Protein import assays using isolated mitochondria

    • Binding assays with known TIM complex partners

    • Complementation studies in TIM54-deficient yeast strains

  • Biophysical Characterization:

    • Thermal stability assays to determine protein stability

    • Size exclusion chromatography with multi-angle light scattering (SEC-MALS) to assess oligomeric state

What are the key considerations when designing experiments to study TIM54's role in mitochondrial function?

When investigating TIM54's role in mitochondrial function, researchers should consider:

  • Genetic Approaches:

    • Generate conditional knockdown or knockout strains (complete deletion may be lethal)

    • Use site-directed mutagenesis to target specific functional domains

    • Implement CRISPR/Cas9 for precise genome editing

  • Physiological Parameters to Monitor:

    • Mitochondrial membrane potential

    • Oxygen consumption rates

    • ATP production

    • Reactive oxygen species (ROS) generation

    • Mitochondrial morphology and distribution

  • Protein-Protein Interaction Studies:

    • Co-immunoprecipitation with other TIM complex components

    • Proximity labeling techniques (BioID, APEX)

    • Yeast two-hybrid or split-ubiquitin assays for membrane protein interactions

  • Controls and Validations:

    • Include wild-type controls in all experiments

    • Use multiple approaches to confirm key findings

    • Compare results across different growth conditions to assess context-dependency

What is the relationship between TIM54 function and C. neoformans virulence mechanisms?

The relationship between TIM54 function and C. neoformans virulence likely involves several interconnected mechanisms:

How might TIM54 dysfunction impact titan cell formation in C. neoformans?

TIM54 dysfunction could impact titan cell formation through several potential mechanisms:

  • Energy Production: Titan cell formation is energetically demanding and requires functional mitochondria. Disruption of TIM54 would impair mitochondrial protein import, potentially reducing ATP production necessary for cell enlargement.

  • Metabolic Reprogramming: Gene expression analysis during titan cell formation shows overexpression of enzymes involved in carbohydrate metabolism . TIM54 dysfunction could disrupt the import of key metabolic enzymes required for this metabolic shift.

  • Iron Utilization: Iron limitation induces titan cell formation , and many iron-dependent enzymes are located in mitochondria. TIM54 dysfunction might alter iron metabolism pathways that regulate titan cell development.

  • Signaling Pathways: The PKC signaling pathway is involved in titan cell formation . Mitochondria participate in cellular signaling networks, and TIM54 dysfunction could disrupt signaling cascades necessary for initiating and maintaining titan cell morphology.

What evidence supports TIM54 as a potential antifungal target?

Several lines of evidence suggest TIM54 could be a promising antifungal target:

  • Essential Function: As a component of the mitochondrial protein import machinery, TIM54 likely serves an essential function in C. neoformans, making it an attractive drug target.

  • Uniqueness to Fungi: While mitochondrial protein import is conserved across eukaryotes, fungal-specific features of TIM54 could potentially be exploited for selective targeting.

  • Connection to Virulence: Mitochondrial function has been implicated in cryptococcal pathogenesis . Compounds targeting fungal mitochondria, such as ALTOX094 and ALTOX102, have demonstrated strong inhibitory effects against C. neoformans growth and viability .

  • Novel Mechanism of Action: With increasing antifungal resistance, targets with novel mechanisms of action are urgently needed. TIM54 represents a pathway distinct from current antifungal drug targets.

How can researchers evaluate compounds that potentially target TIM54 or related mitochondrial functions?

Researchers can evaluate potential TIM54-targeting compounds through a systematic approach:

  • In Vitro Binding and Inhibition Assays:

    • Direct binding assays using purified recombinant TIM54

    • Functional inhibition assays of protein import in isolated mitochondria

    • Structural studies to identify binding sites (e.g., using HDX-MS or cryo-EM)

  • Cellular Assays:

    • Growth inhibition assays under different conditions (37°C, 30°C)

    • Minimum Inhibitory Concentration (MIC90) determination

    • Assessment of compound effects on wild-type vs. mitochondrial mutant strains

  • Specificity Evaluation:

    • Comparison of effects on fungal vs. human mitochondrial function

    • Structure-activity relationship studies to improve selectivity

    • Testing against various C. neoformans serotypes and strains

  • Mechanistic Studies:

    • Membrane permeability assays to assess mode of action

    • Cell death mechanism determination (apoptosis vs. necrosis)

    • Mitochondrial function measurements (membrane potential, respiration)

Recent research with mitochondria-targeted compounds (ALTOX094 and ALTOX102) demonstrated that structural features like alkyl chain length significantly influence antifungal activity and mechanism of action . These compounds showed strong inhibitory effects against C. neoformans despite differences in their modes of action, suggesting that mitochondrial targeting is a promising strategy for antifungal development.

How does TIM54 interact with the Alternative Oxidase (Aox) pathway in C. neoformans?

The relationship between TIM54 and the Alternative Oxidase (Aox) pathway represents an intriguing area for investigation:

  • Functional Intersection: Both TIM54 and Aox are mitochondrial proteins with potential roles in stress response and virulence. TIM54 may be involved in the import of Aox precursors into mitochondria.

  • Metabolic Adaptation: The Aox pathway provides metabolic flexibility during respiratory inhibition or oxidative stress, conditions where proper mitochondrial protein import through TIM54 would be crucial.

  • Research Approach: Studies comparing wild-type and Δaox1 deletion strains under various conditions, particularly those that stress mitochondrial function, could reveal functional interactions between these pathways .

  • Therapeutic Implications: Compounds targeting both the regular respiratory chain and the alternative pathway (like ALTOX102) show promise as antifungals . Understanding how TIM54 dysfunction might affect these pathways could inform combination therapy approaches.

What methodological advances would enhance our understanding of TIM54's role in mitochondrial dynamics during infection?

Several methodological advances could significantly enhance our understanding of TIM54's role during infection:

  • In Vivo Imaging Technologies:

    • Development of fluorescent reporters for monitoring TIM54 expression and localization in live cells during infection

    • Real-time tracking of mitochondrial dynamics in C. neoformans within host tissues

  • Conditional Expression Systems:

    • Tetracycline-regulated or other inducible systems for controlled manipulation of TIM54 expression during different stages of infection

    • Temperature-sensitive alleles for acute inactivation studies

  • Single-Cell Analysis:

    • Single-cell transcriptomics to capture heterogeneity in TIM54 expression during infection

    • Spatial transcriptomics to correlate TIM54 expression with tissue microenvironments

  • Improved In Vitro Models:

    • Development of host-relevant in vitro conditions that better mimic infection sites

    • Co-culture systems with host immune cells to study TIM54's role during host-pathogen interactions

  • Integrative Multi-Omics:

    • Combined proteomics, metabolomics, and transcriptomics approaches to comprehensively map TIM54's impact on mitochondrial function

    • Network analysis to place TIM54 in the context of broader cellular responses during infection

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.