Recombinant Cryptococcus neoformans var. neoformans serotype D Mitochondrial intermembrane space import and assembly protein 40 (MIA40)

Shipped with Ice Packs
In Stock

Description

Overview of MIA40

Mitochondrial intermembrane space import and assembly protein 40 (MIA40) acts as a trans-site receptor that facilitates protein import into the mitochondrial intermembrane space (IMS) through hydrophobic substrate binding . This protein is essential for oxidizing and importing proteins with conserved cysteines into the IMS, forming disulfide bonds during the import process .

Importance of Substrate Binding

Research indicates that the ability of MIA40 to bind proteins, rather than its enzyme activity, is crucial for importing proteins into the intermembrane space . The hydrophobic substrate-binding pocket on the surface of MIA40 is essential for the import and folding of IMS proteins . This region facilitates the binding and oxidation of MIA40 substrates and also binds to Erv1 .

MIA40 substrates contain internal signals, known as mitochondrial intermembrane space sorting (MISS) or internal targeting sequences (ITS), that specifically dock onto this binding region, thereby selecting cysteine residues for interaction with the redox-active cysteine pair in MIA40 .

Experimental Analysis of MIA40 Mutants

Studies involving yeast mutants have helped to dissect the activities of MIA40 . Mutants lacking the redox-active cysteine pair (Mia40-SPS) or the substrate-binding pocket (Mia40-FE and Mia40-STOP) were generated to analyze the structural elements of MIA40 . The Mia40-SPS mutant still mediates protein import of MIA40 substrates with high efficiency, allowing the accumulation of MIA40 substrates in mitochondria, albeit at reduced levels . This suggests that the trapping activity of MIA40 is essential, with MIA40 serving as a trans-site receptor that drives the translocation of proteins across the outer membrane .

Redox State and Disulfide Bonds

MIA40 contains two structural disulfide bonds crucial for the functionality of the substrate-binding pocket . Experiments using alkylating agents revealed that Mia40 variants can be expressed in the IMS of mitochondria, lacking either the redox-active cysteine pair but containing a correctly folded substrate-binding domain, or lacking a functional substrate-binding domain but containing the cysteine-proline-cysteine motif .

Overexpression of MIA40

Overexpression of MIA40 leads to higher cellular levels of MIA40 substrates, such as Atp23, Tim10, and Cmc1 . The endogenous levels of MIA40 are rate-limiting under physiological conditions, suggesting that only a fraction of the MIA40 substrates initially synthesized in the cytosol accumulate as stable proteins in vivo . Overexpression of MIA40 increases this fraction .

MIA40 in Cryptococcus neoformans

Mitochondrial morphology maintenance in Cryptococcus neoformans is critical for stress resistance and virulence . The Cryptococcus neoformans Mar1 protein is essential for proper fungal cell wall ordering in response to host-relevant stresses .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is finalized during production. Please specify your required tag type for preferential development.
Synonyms
MIA40; TIM40; CNBE4300; Mitochondrial intermembrane space import and assembly protein 40; Mitochondrial import inner membrane translocase TIM40
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
19-242
Protein Length
Full Length of Mature Protein
Species
Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) (Filobasidiella neoformans)
Target Names
MIA40
Target Protein Sequence
STRSGPAPSSLWSSRNAVIAGTTLAITALAVTSERRKVFNESAQKATSPRDSIIAQDSLK ENVHKKSVRQDEFSGESTKPEASTSSDSVEKAADDAAQILEEKEAEASEPSQGAYNPETG EINWDCPCLGGMATGPCGEQFKAAFSCFVYSEAEPKGVDCVELFKVMQDCFREHPEIYGE VDTLGLVLMFYAEIDDDEAPPQEGTMEEKVEAAKEETAAPAAAP
Uniprot No.

Target Background

Function

Essential for the import and folding of small, cysteine-rich proteins (small Tims) within the mitochondrial intermembrane space (IMS). MIA40 functions in a redox cycle with ERV1, utilizing a disulfide relay system. Precursor proteins destined for the IMS are imported in a reduced state. Oxidized MIA40 forms a transient disulfide bond with the reduced precursor, oxidizing the precursor protein and enabling its intramolecular disulfide bond formation and subsequent folding within the IMS.

Database Links
Subcellular Location
Mitochondrion inner membrane; Single-pass type II membrane protein; Intermembrane side.

Q&A

What are the key structural components of Cryptococcus neoformans MIA40 protein?

Cryptococcus neoformans var. neoformans serotype D MIA40 is a 224-amino acid mature protein (residues 19-242) containing two conserved functional elements: an N-terminal redox-active CPC motif and a C-terminal hydrophobic substrate-binding pocket . These elements are critical for its dual function in the mitochondrial intermembrane space. The full amino acid sequence includes specific cysteine-containing motifs that form the functional core of the protein. Structurally, MIA40 contains a twin Cx9C domain that forms the substrate-binding region, which is essential for recognizing and binding incoming proteins .

What is the primary cellular role of MIA40 in fungal species?

Research has demonstrated that MIA40 functions primarily as a trans-site receptor in the mitochondrial intermembrane space (IMS) . This function involves binding incoming proteins via hydrophobic interactions through its substrate-binding pocket, thereby mediating protein translocation across the outer mitochondrial membrane. Studies using MIA40 variants with mutated domains (MIA40-SPS, MIA40-FE) have established that the substrate-binding function is essential and sufficient for protein import, while the oxidoreductase activity, though important, plays a secondary role that occurs after translocation .

How does Cryptococcus neoformans MIA40 compare to homologs in other species?

While the core structure and function of MIA40 are conserved across fungal species, the Cryptococcus neoformans variant exhibits some unique characteristics. The recombinant protein has a molecular weight corresponding to its 224-amino acid sequence (19-242) with distinctive features including the conserved CPC motif and substrate-binding domain . Comparative studies with Saccharomyces cerevisiae MIA40 have shown that both proteins serve as essential components of the mitochondrial disulfide relay system, though specific substrate recognition patterns may vary between species.

What techniques are most effective for analyzing MIA40 redox states?

The most effective technique for analyzing MIA40 redox states involves alkylation-based assays followed by electrophoretic separation. This methodology requires:

  • Isolation of mitochondria containing MIA40

  • Protein precipitation with trichloroacetic acid (TCA) to preserve native redox states

  • Treatment with maleimide-based alkylating agents (mmPEG24 or mmPEG12)

  • Analysis by SDS-PAGE to detect mobility shifts

This approach allows researchers to distinguish between different redox species of MIA40. For example, studies have shown that MIA40 exhibits two distinct forms: one with an oxidized CPC motif and another with a reduced CPC motif, while maintaining the structural disulfides of the substrate-binding domain . The alkylating agents cause mass shifts of approximately 1.2 kDa (mmPEG24) or 0.7 kDa (mmPEG12) per modified thiol group, enabling precise determination of the number of reduced cysteines.

How can researchers effectively reconstitute recombinant MIA40 for functional studies?

To effectively reconstitute recombinant Cryptococcus neoformans MIA40 for functional studies, researchers should follow this methodology:

  • Reconstitute lyophilized protein in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (optimally 50%) for stability

  • Briefly centrifuge vials before opening to bring contents to the bottom

  • Prepare small working aliquots to avoid repeated freeze-thaw cycles

  • Store working aliquots at 4°C for up to one week and long-term storage at -20°C/-80°C

Proper reconstitution is critical for maintaining the functional integrity of MIA40, particularly the correct formation of its disulfide bonds that are essential for substrate binding and oxidative folding activities.

What methods can be used to study protein-protein interactions involving MIA40?

Several complementary methods can be employed to study MIA40 protein interactions:

  • Co-immunoprecipitation during import reactions:

    • This approach has successfully detected non-covalent interactions between MIA40-SPS variants and substrates like Tim9 and Cmc1

    • The technique reveals substrate binding independent of disulfide formation

  • Redox state analysis of interaction partners:

    • Using alkylation assays (mmPEG24/mmPEG12) to monitor disulfide transfer

    • This has revealed that Mia40-SPS can bind substrates but cannot form mixed disulfides

  • Genetic complementation assays:

    • Expression of MIA40 variants in MIA40-depleted cells

    • Monitoring restoration of substrate protein levels in mitochondria

  • In vitro import assays with isolated mitochondria:

    • Using radiolabeled substrate proteins to monitor import efficiency

    • Comparing wild-type and mutant MIA40 proteins to dissect specific functions

These approaches have demonstrated that the substrate-binding pocket of MIA40 is both necessary and sufficient for the initial recognition and import of substrate proteins .

How does the disulfide relay system involving MIA40 and Erv1 operate mechanistically?

The disulfide relay system operates through a coordinated sequence of electron transfer events:

  • Initial substrate binding:

    • MIA40's hydrophobic pocket recognizes incoming reduced proteins

    • This binding is independent of the redox-active CPC motif

  • Disulfide transfer:

    • The oxidized CPC motif of MIA40 forms mixed disulfides with substrate cysteines

    • This promotes oxidative folding of the substrate protein

  • MIA40 reoxidation:

    • Erv1 interacts with reduced MIA40 to reoxidize its CPC motif

    • This regenerates MIA40 for subsequent rounds of substrate oxidation

  • Electron flow to respiratory chain:

    • Erv1 transfers electrons to cytochrome c or oxygen

    • This completes the electron transfer pathway

Importantly, research has shown that overexpression of Erv1 in a MIA40-SPS background does not improve but rather reduces import efficiency of substrates like Atp23 and Cmc1 . This suggests competitive binding between Erv1 and incoming substrates to the MIA40 binding pocket, highlighting the importance of proper coordination between components of the disulfide relay system.

How can chemical oxidants influence MIA40-dependent protein import pathways?

Chemical oxidants like diamide can significantly influence MIA40-dependent protein import:

  • Suppression of growth defects:

    • Addition of diamide partially suppresses growth defects in yeast cells expressing MIA40-SPS (lacking the redox-active CPC motif)

    • This indicates that chemical oxidation can partially compensate for the loss of MIA40's oxidoreductase activity

  • Substrate oxidation in the absence of functional MIA40:

    • Studies have shown that in MIA40-SPS mutants, substrates like Tim10 can still form proper disulfides

    • This suggests that chemical oxidants can drive oxidative folding in the IMS when MIA40's redox function is compromised

  • Mechanistic implications:

    • These findings indicate that while the substrate-binding function of MIA40 is essential, its oxidoreductase activity can be partially bypassed

    • The substrate specificity of the mitochondrial disulfide relay may not be absolutely necessary if alternative oxidation mechanisms are available

This research highlights the distinction between MIA40's essential role in protein translocation and its important but potentially dispensable role in oxidative folding.

What is the evidence for MIA40 as a rate-limiting factor in mitochondrial protein import?

Several experimental findings establish MIA40 as a rate-limiting factor in mitochondrial protein import:

  • Overexpression effects:

    • Overexpression of MIA40 leads to significantly higher cellular levels of MIA40 substrates including Atp23, Tim10, and Cmc1

    • This indicates that endogenous MIA40 levels restrict the amount of substrate proteins that accumulate in the IMS

  • Direct import measurements:

    • Mitochondria isolated from MIA40-overexpressing cells show substantially improved import efficiency for substrates like Cmc1, Atp23, and Tim9

    • This directly demonstrates that MIA40 availability limits import capacity

  • Broader mitochondrial effects:

    • Surprisingly, MIA40 levels influence even proteins not directly dependent on MIA40 for import

    • For example, cytochrome b₂ levels are affected by MIA40 availability, likely through indirect mechanisms involving other MIA40 substrates

What are critical considerations when designing experiments with recombinant MIA40?

When designing experiments with recombinant Cryptococcus neoformans MIA40, researchers should consider:

  • Protein stability factors:

    • Use freshly reconstituted protein or maintain at 4°C for short-term use

    • Avoid repeated freeze-thaw cycles that can disrupt disulfide bonds

    • Include trehalose (6%) in storage buffer to maintain protein stability

  • Experimental conditions:

    • Control redox environment to preserve native disulfide arrangement

    • Optimize buffer conditions (pH 8.0 is recommended for storage)

    • Consider the effect of temperature on protein activity

  • Analytical approaches:

    • Verify protein integrity by SDS-PAGE before functional assays

    • Consider including positive controls in binding or activity assays

    • Use appropriate detection methods based on the His-tag present in recombinant preparations

  • Functional validation:

    • Compare results with established model systems such as S. cerevisiae MIA40

    • Validate activity through substrate binding or oxidation assays

    • Consider the effect of protein concentration on assay outcomes

These considerations ensure reliable and reproducible results when working with recombinant MIA40 protein.

How can researchers troubleshoot issues in MIA40-dependent import assays?

When troubleshooting MIA40-dependent import assays, researchers should address these common issues:

  • Low import efficiency:

    • Check mitochondrial integrity and membrane potential

    • Verify the reduced state of substrate proteins before import

    • Consider using MIA40-upregulated mitochondria to enhance import capacity

    • Optimize ATP and NADH concentrations in import buffers

  • Inconsistent substrate oxidation:

    • Examine the redox state of MIA40 in isolated mitochondria

    • Verify Erv1 functionality in the disulfide relay system

    • Control oxygen levels during the import reaction

    • Consider the presence of competing reductants in the reaction buffer

  • Poor detection of MIA40-substrate interactions:

    • Optimize crosslinking conditions if studying transient interactions

    • Adjust detergent concentrations during solubilization to preserve interactions

    • Consider the timing of analysis, as some interactions may be highly transient

    • Use appropriate negative controls (e.g., MIA40-STOP variant) that lack substrate binding capacity

  • Inconsistent results between in vitro and in vivo studies:

    • Consider the influence of proteases (e.g., Yme1) on substrate stability in vivo

    • Evaluate the contribution of redundant pathways in cellular systems

    • Account for differences in redox environment between isolated mitochondria and intact cells

Systematic troubleshooting using this approach can help researchers obtain more consistent and biologically relevant results in MIA40 research.

How can structural and functional MIA40a variants be used to dissect specific aspects of its function?

Structural and functional MIA40 variants provide powerful tools for dissecting specific aspects of protein function:

  • CPC motif variants (e.g., MIA40-SPS):

    • Replace the redox-active cysteines with serines

    • These variants retain substrate binding but lose oxidoreductase activity

    • Useful for distinguishing between translocation and oxidation functions

    • Studies show these variants can partially support substrate import but not oxidative folding

  • Substrate-binding pocket variants (e.g., MIA40-FE):

    • Replace conserved hydrophobic residues (phenylalanines) with charged residues (glutamates)

    • These mutations disrupt substrate binding but maintain the CPC motif

    • Studies show these variants fail to support substrate import, highlighting the essential nature of the binding function

  • Truncation variants (e.g., MIA40-STOP):

    • Remove the entire substrate-binding domain while retaining the CPC motif

    • These variants cannot bind substrates or support their import

    • Useful for studying the interdependence of MIA40 domains

Experimental design using these variants has revealed key insights:

  • The substrate-binding function is essential and cannot be bypassed

  • The oxidoreductase function, while important, is partially dispensable

  • Both functions must be present in the same protein molecule, as co-expression of separate variants (MIA40-SPS + MIA40-FE) fails to restore function

This approach has been instrumental in establishing MIA40's primary role as a trans-site receptor that drives protein translocation, with its oxidoreductase activity playing an important but secondary role.

What is the potential significance of MIA40 research for understanding fungal pathogenesis?

Research on Cryptococcus neoformans MIA40 has significant implications for understanding fungal pathogenesis:

  • Mitochondrial function in virulence:

    • Proper mitochondrial function is essential for fungal virulence factors

    • MIA40-dependent proteins include components critical for respiration and energy metabolism

    • Many virulence factors require functional mitochondria for their production

  • Unique aspects of fungal protein import:

    • Differences between fungal and human mitochondrial protein import pathways

    • The C. neoformans MIA40 sequence and structure may reveal fungal-specific features

    • These differences could potentially be exploited for antifungal development

  • Stress adaptation mechanisms:

    • Mitochondrial function is critical for adaptation to host environmental stresses

    • The disulfide relay system may play roles in redox homeostasis during infection

    • Understanding how C. neoformans maintains mitochondrial function during infection could reveal novel virulence mechanisms

The continued study of C. neoformans MIA40 structure, function, and interactions may reveal novel targets for antifungal interventions while deepening our understanding of the role of mitochondria in fungal pathogenesis.

How might advanced techniques enhance our understanding of MIA40 function?

Advanced techniques that could enhance MIA40 research include:

  • Cryo-electron microscopy:

    • Determination of high-resolution structures of MIA40-substrate complexes

    • Visualization of conformational changes during substrate binding and oxidation

    • Structural comparison between fungal and human MIA40 proteins

  • Single-molecule approaches:

    • Real-time monitoring of MIA40-substrate interactions

    • Direct observation of conformational changes during the import process

    • Kinetic analysis of the complete import and oxidation cycle

  • Systems biology approaches:

    • Comprehensive identification of all MIA40 substrates in C. neoformans

    • Network analysis of MIA40-dependent processes in mitochondrial function

    • Comparative analysis across fungal species to identify conserved and variable features

  • In vivo imaging techniques:

    • Visualization of protein import in living cells

    • Spatial and temporal resolution of the import process

    • Correlation of import efficiency with mitochondrial function and cellular physiology

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.