Recombinant Cryptococcus neoformans var. neoformans serotype D Protein GET1 (GET1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
GET1; CNBG3700; Protein GET1; Guided entry of tail-anchored proteins 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-215
Protein Length
full length protein
Species
Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) (Filobasidiella neoformans)
Target Names
GET1
Target Protein Sequence
MINLALVIFLCTLLNQIVSWVGKSVLQEIAFTAYSWVFLSGTAAKQRKLRKQVLEDKAEL GRTSSQDEFAKWAKLRRKLDKGLADLEKTNNTLSSSRSSFSKKFSTLLWLMTTGAQFLLS WWFRKQPIFWLPEGWVPYPVAWLLSFPSAPIGSVSSGAWGAICRRVLSTLQEIIQSVLAP SPAATGPVPTGPSSAKNDQPEAKIEALALEHEKLD
Uniprot No.

Target Background

Function
Essential for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum. Functions as a membrane receptor for soluble GET3, which specifically recognizes and binds the transmembrane domain of TA proteins in the cytosol.
Database Links
Protein Families
WRB/GET1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure and function of Cryptococcus neoformans GET1 protein?

While specific structural data for GET1 is still emerging, research on other Cryptococcus neoformans proteins such as antiphagocytic protein 1 (App1) suggests that cysteine content significantly influences protein structure and function. For example, C. neoformans var. grubii App1 contains seven cysteine residues, creating the potential for intermolecular disulfide bridges that can lead to amyloid fibril formation in the absence of reducing agents like β-mercaptoethanol or DTT in vitro . When characterizing GET1, researchers should employ similar analytical techniques including SDS-PAGE, gel filtration chromatography, circular dichroism, and fluorescence spectroscopy to determine its structural characteristics and functional domains.

How does GET1 compare to other well-characterized proteins in Cryptococcus neoformans?

In Cryptococcus neoformans, several proteins have been well-characterized and may provide comparative insights for GET1 research. The G-protein α subunit (GPA1) has been established as a critical regulator of mating and virulence . Similarly, the aspartyl protease Pep1p has demonstrated potential as an immunization target . When studying GET1, researchers should consider performing comparative analyses with these proteins to identify potential functional overlaps or distinct pathways. Such comparisons should focus on gene expression patterns, protein localization, and phenotypic effects of gene disruption, which have provided valuable insights for other cryptococcal proteins.

What are the optimal expression systems for producing recombinant GET1?

Based on experience with other Cryptococcus proteins, researchers have multiple options for GET1 expression. For App1, both insect cell lines (Lepidopteran High Five™) using pIZ/V5-His vectors and lentiviral systems have been explored with varying success . When selecting an expression system for GET1, researchers should consider:

Expression SystemAdvantagesDisadvantagesRecommended Applications
E. coliCost-effective, high yield, rapid growthPotential for inclusion bodies, limited post-translational modificationsInitial characterization, structural studies
Insect cellsBetter post-translational modifications, potential for higher solubilityMore expensive, slower growthFunctional studies requiring native-like protein
Lentiviral systemsMammalian post-translational modificationsComplex setup, lower yieldsIn vivo studies, interactions with host factors

The choice should be guided by whether soluble protein is required or if refolding from inclusion bodies is acceptable based on the research objectives.

What purification strategies are most effective for isolating recombinant GET1?

When purifying recombinant GET1, researchers should consider the following multi-step approach based on successful strategies for other Cryptococcus proteins:

  • Affinity chromatography using histidine or other fusion tags as the initial capture step

  • Ion exchange chromatography for intermediate purification

  • Size exclusion chromatography for final polishing and to assess protein oligomerization state

Importantly, if GET1 contains multiple cysteine residues similar to App1, researchers must carefully consider buffer conditions, particularly the inclusion of reducing agents to prevent inappropriate disulfide bridge formation and potential aggregation . Optimization of these conditions should be performed systematically, testing various pH values, salt concentrations, and reducing agent concentrations to determine optimal stability and solubility of the purified protein.

What methods are most effective for studying GET1's role in Cryptococcus neoformans virulence?

To thoroughly investigate GET1's potential role in virulence, researchers should implement a multi-faceted approach similar to that used for GPA1 and other virulence-associated proteins :

  • Generate targeted gene disruption strains using homologous recombination techniques

  • Evaluate phenotypic changes in known virulence factors (melanin production, capsule formation)

  • Assess changes in response to environmental signals (nitrogen starvation, glucose limitation, iron restriction)

  • Confirm phenotypes through genetic complementation with the wild-type gene

  • Conduct in vivo virulence assessment using established animal models of cryptococcosis

The rabbit model of cryptococcal meningitis has been effective for studying GPA1's contribution to pathogenicity , while mouse models have been informative for evaluating Pep1p's immunization potential . Researchers should select appropriate models based on their specific research questions regarding GET1.

How can gene expression analysis help understand GET1's role in different infection stages?

Gene expression analysis of GET1 during infection can provide critical insights into its biological relevance. Researchers studying PEP1 have observed differential expression between in vitro and in vivo conditions, with significant variation depending on the cryptococcal strain and infected organ . For GET1 expression studies, consider:

  • Comparing expression levels between laboratory growth conditions and infected tissues

  • Establishing a detection threshold (typically 10^6 CFU/g of organ for reliable detection)

  • Analyzing strain-specific differences in expression patterns

  • Correlating expression levels with fungal burden and disease progression

Quantitative PCR remains the gold standard for these analyses, but RNA-seq approaches can provide a more comprehensive view of GET1 expression in the context of global transcriptional responses.

What techniques are most suitable for identifying GET1 interaction partners?

Understanding protein-protein interactions is crucial for elucidating GET1's biological function. Researchers should consider employing multiple complementary approaches:

  • Yeast two-hybrid screening to identify potential interacting proteins

  • Co-immunoprecipitation followed by mass spectrometry for validation in native contexts

  • Surface plasmon resonance or biolayer interferometry for quantitative binding kinetics

  • Proximity labeling approaches (BioID or APEX) for capturing transient interactions

When interpreting results, researchers should be mindful that cryptococcal proteins may interact differently with host proteins versus fungal proteins, necessitating validation in both contexts. Control experiments using non-specific proteins of similar size and charge are essential to distinguish meaningful interactions from background binding.

How does GET1 potentially interact with host immune components?

Based on studies of App1, which inhibits phagocytosis via complement-mediated mechanisms , and Pep1p, which elicits protective antibody responses , researchers investigating GET1 should consider:

  • Evaluating interactions with complement components using ELISA and surface plasmon resonance

  • Assessing effects on phagocytosis using fluorescently labeled Cryptococcus and flow cytometry

  • Measuring impacts on phagosome maturation using confocal microscopy and relevant markers

  • Investigating potential antigenic properties through antibody development and immunization studies

These investigations should include appropriate controls and be conducted with both human and model organism immune components to ensure translational relevance.

What are the optimal methods for generating GET1 knockout strains?

Creating GET1 knockout strains requires careful consideration of Cryptococcus neoformans transformation efficiency and homologous recombination rates. Based on successful strategies for GPA1 disruption , researchers should:

  • Design disruption constructs with selection markers (e.g., ADE2 for adenine prototrophy)

  • Use biolistic transformation for highest efficiency gene replacement

  • Screen transformants for proper integration using both PCR and Southern blot analysis

  • Verify single or tandem integration patterns at the target locus

  • Confirm disruption through reverse transcription PCR and/or Western blot analysis

It's critical to generate complemented strains by reintroducing the wild-type GET1 gene to confirm that observed phenotypes are specifically due to GET1 disruption rather than secondary mutations or effects.

What phenotypic assays should be used to characterize GET1 mutant strains?

Comprehensive phenotypic characterization of GET1 mutants should include assessments of:

  • Growth under various conditions (temperature, pH, nutrient limitation)

  • Stress responses (oxidative, nitrosative, osmotic)

  • Cell wall and membrane integrity

  • Mating efficiency under nitrogen starvation conditions

  • Virulence factor production (melanin synthesis, capsule formation)

  • In vivo pathogenicity using appropriate animal models

Based on findings with GPA1 mutants, researchers should particularly focus on environmental signal responses that might be regulated by GET1 . Additionally, testing whether exogenous signaling molecules can suppress GET1 mutant phenotypes (as cAMP does for GPA1 mutants) could reveal downstream signaling pathways.

How can GET1 be exploited for potential vaccine development against cryptococcosis?

Building on findings that antibodies against Pep1p confer significant protection against C. neoformans infection , researchers investigating GET1's potential as a vaccine target should:

  • Evaluate both prophylactic and therapeutic vaccination approaches using recombinant GET1

  • Assess antibody development specificity and titers following immunization

  • Measure survival rates and fungal burden in appropriate animal models

  • Investigate mechanisms of protection, including enhanced phagocytosis and/or inhibition of fungal multiplication

  • Develop and characterize monoclonal antibodies against GET1 for potential passive immunization strategies

Research has shown that mice developing antibodies against Pep1p had significantly improved survival during C. neoformans infection , suggesting that similar approaches could be valuable if GET1 proves to be immunogenic and accessible to antibodies during infection.

How might advanced structural biology techniques enhance our understanding of GET1?

Advanced structural biology techniques can provide crucial insights into GET1's function and potential as a therapeutic target:

  • X-ray crystallography or cryo-electron microscopy for high-resolution structure determination

  • Hydrogen-deuterium exchange mass spectrometry for identifying dynamic regions and binding interfaces

  • Molecular dynamics simulations to understand conformational changes and potential druggable pockets

  • Structure-based drug design for developing GET1 inhibitors as potential antifungal agents

When interpreting structural data, researchers should pay particular attention to cysteine residues and disulfide bridge formation, as these have proven critical for understanding App1's behavior in vitro .

How conserved is GET1 across Cryptococcus species and strains?

Understanding GET1's conservation can provide insights into its functional importance and evolution:

  • Perform phylogenetic analyses comparing GET1 sequences across Cryptococcus species and strains

  • Identify conserved domains that may indicate functionally critical regions

  • Compare GET1 expression patterns between virulent and less virulent strains

  • Assess whether GET1 variation correlates with differences in host specificity or virulence

Similar analyses of App1 revealed that C. neoformans var. neoformans and C. gattii App1 contain six cysteine residues, while C. neoformans var. grubii App1 contains seven , potentially influencing protein function and virulence differences between these variants.

Are there homologs of GET1 in other fungal pathogens?

Identifying potential GET1 homologs in other fungal species can provide evolutionary context and potentially reveal conserved pathogenic mechanisms:

  • Conduct BLAST searches and more sensitive profile-based searches (HMM, PSSM) against fungal genome databases

  • Analyze synteny of genomic regions containing GET1 and potential homologs

  • Compare expression patterns of homologs during infection across fungal species

  • Assess functional conservation through heterologous expression and complementation studies

If GET1 proves unique to Cryptococcus, like App1 , this would suggest a specialized function potentially tied to this pathogen's unique virulence mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.