Recombinant Cryptococcus neoformans var. neoformans serotype D Protein SYM1 (SYM1)

Shipped with Ice Packs
In Stock

Description

Definition and Nomenclature

SYM1 is a full-length protein (1–190 amino acids) encoded by the SYM1 gene (UniProt ID: P0CQ38) in C. neoformans serotype D. The recombinant version includes an N-terminal histidine (His) tag for purification and detection. Its sequence (MAGLMGKYAAFLTRRPVLGNMISSAVLFGTGDVIAQQLIEKKGADHDLPRTARIVTWGGILFAPTVNLWFRTLERIPIRSRWPATFARVGLDQFGFAPVILSGFFTAMTFMEGKDFNAAKVKWHESFFPTLQANWMLFIPFQILNMGLVPLQYRLLAVNAVNIPWNAFLSLQNAKGRKAEDPVAISKKE) is conserved in serotype D strains .

Production and Biochemical Characteristics

SYM1 is expressed in E. coli and purified to >90% homogeneity via chromatography. Key specifications include:

ParameterSpecification
Expression SystemE. coli
Protein LengthFull-length (1–190 amino acids)
TagN-terminal His-tag
Purity>90% (SDS-PAGE verified)
Storage BufferTris/PBS-based buffer, 6% trehalose, pH 8.0
ApplicationsSDS-PAGE, structural studies, immunology

Reconstitution is performed in deionized sterile water (0.1–1.0 mg/mL), with glycerol (5–50%) recommended for long-term storage at −20°C/−80°C .

Functional and Research Context

While SYM1 is commercially available for laboratory use, its biological role remains poorly characterized. Unlike other C. neoformans proteins (e.g., Bim1, Sbh1, Olp1), SYM1 lacks documented involvement in virulence, stress responses, or sexual development . This contrasts with proteins like:

  • Bim1: Critical for filamentous growth and nuclear congression .

  • Sbh1: Regulates ER translocation of virulence factors .

  • Olp1: Required for sexual reproduction and virulence .

SYM1’s absence in functional studies suggests it may serve niche roles or require further investigation.

Applications in Research

SYM1 is primarily used as a tool for:

  1. Structural Analysis: SDS-PAGE validation and protein interaction studies .

  2. Immunological Studies: Development of antibodies for detecting SYM1 in C. neoformans samples.

  3. Comparative Genomics: Phylogenetic analysis to distinguish serotype D from other C. neoformans variants .

Research Gaps and Future Directions

  • Functional Annotation: No studies link SYM1 to pathogenesis, capsular formation, or host interaction.

  • Expression Patterns: Limited data on SYM1 expression under stress (e.g., temperature, immune pressure) or during infection.

  • Comparative Analysis: Potential role in serotype-specific traits (e.g., thermal susceptibility) remains unexplored .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we understand that you might have specific requirements. Should you need a particular format, please indicate your preference in the order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is preferred, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. We suggest storing working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we advise adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life of our products is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is recommended to minimize freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production process. If you have a specific tag type in mind, please inform us and we will prioritize developing the specified tag.
Synonyms
SYM1; CNA06860; Protein SYM1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-190
Protein Length
full length protein
Species
Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) (Filobasidiella neoformans)
Target Names
SYM1
Target Protein Sequence
MAGLMGKYAAFLTRRPVLGNMISSAVLFGTGDVIAQQLIEKKGADHDLPRTARIVTWGGI LFAPTVNLWFRTLERIPIRSRWPATFARVGLDQFGFAPVILSGFFTAMTFMEGKDFNAAK VKWHESFFPTLQANWMLFIPFQILNMGLVPLQYRLLAVNAVNIPWNAFLSLQNAKGRKAE EDPVAISKKE
Uniprot No.

Target Background

Function
SYM1 (SYM1) may play a role in cellular response to stress. It is essential for maintaining mitochondrial DNA (mtDNA) integrity and stability.
Database Links

KEGG: cne:CNA06860

Protein Families
Peroxisomal membrane protein PXMP2/4 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is SYM1 and what is its functional role in C. neoformans var. neoformans?

SYM1 is a protein found in Cryptococcus neoformans that belongs to the family of stress-responsive proteins. While not explicitly detailed in the provided research, SYM1 likely functions similarly to related proteins in other fungi that participate in stress response pathways. C. neoformans must adapt to various environmental stressors during infection, including temperature shifts when transitioning from environmental sources to the human host . The protein may be involved in maintaining cellular homeostasis during these transitions.

The protein's function should be investigated in context of C. neoformans' remarkable adaptability, particularly its ability to survive in varied pH environments and temperature conditions, which are crucial virulence factors .

How does SYM1 expression differ between serotype D and serotype A strains?

C. neoformans var. neoformans (serotype D) strains demonstrate different thermal susceptibility compared to var. grubii (serotype A) strains. Serotype D strains show significantly lower survival rates at elevated temperatures (47°C) compared to serotype A strains . This differential thermal tolerance may correlate with expression patterns of stress-response proteins like SYM1.

To investigate this correlation, researchers should:

  • Perform comparative transcriptomics between serotypes grown at different temperatures

  • Quantify SYM1 mRNA and protein levels using RT-qPCR and Western blotting

  • Generate knockout mutants in both serotypes to assess differential phenotypic impacts

What are the structural characteristics of SYM1 that influence its function?

SYM1's structure should be analyzed through bioinformatic approaches and experimental validation:

  • Sequence analysis to identify conserved domains

  • Structural prediction using crystallography or cryo-EM

  • Functional domain mapping through site-directed mutagenesis

Consider examining whether SYM1 contains any of the extensive intronic structures common in C. neoformans genes, as over 99% of expressed genes in the organism contain multiple introns . This intronic architecture might influence expression regulation under different environmental conditions.

What expression systems yield optimal recombinant SYM1 production?

For recombinant SYM1 production, consider:

Eukaryotic Expression Systems:

  • Pichia pastoris: Advantages include proper protein folding and post-translational modifications

  • Saccharomyces cerevisiae: Useful for functional complementation studies

E. coli-based Expression:

  • BL21(DE3) with pET vectors for high yield production

  • Arctic Express strains for cold-temperature expression to improve folding

Methodological Protocol:

  • Clone the SYM1 coding sequence into appropriate expression vectors

  • Transform expression hosts and screen for high-expressing clones

  • Optimize induction conditions (temperature, time, inducer concentration)

  • Evaluate protein solubility under various buffer conditions

What are effective purification strategies for recombinant SYM1?

A multi-step purification approach is recommended:

  • Initial capture: Affinity chromatography (His-tag, GST-tag)

  • Intermediate purification: Ion exchange chromatography

  • Polishing: Size exclusion chromatography

Buffer Optimization Table:

Purification StageBuffer CompositionpHTemperatureConsiderations
Lysis50 mM Tris-HCl, 300 mM NaCl, 10% glycerol, protease inhibitors7.5-8.04°CInclude stabilizing agents if needed
Affinity Binding50 mM Tris-HCl, 300 mM NaCl, 20 mM imidazole7.54°CLower imidazole reduces non-specific binding
Elution50 mM Tris-HCl, 300 mM NaCl, 250 mM imidazole7.54°CGradient elution may improve purity
Size Exclusion20 mM HEPES, 150 mM NaCl7.04°CAnalyze oligomeric state

Protein stability should be assessed at each purification stage using SDS-PAGE and activity assays.

How can researchers validate the activity of purified recombinant SYM1?

Activity validation requires establishing appropriate functional assays:

  • Thermal stability assays using differential scanning fluorimetry

  • Binding assays with potential interaction partners

  • Complementation studies in SYM1-deficient strains

  • In vitro stress response assays

When designing activity assays, consider the thermal susceptibility differences between serotype D and A strains as a phenotypic readout .

What role might SYM1 play in C. neoformans thermal adaptation?

C. neoformans var. neoformans (serotype D) strains show greater thermal susceptibility than serotype A strains . To investigate SYM1's role:

  • Generate SYM1 knockouts in both serotypes and assess thermal tolerance

  • Compare growth curves at various temperatures (37-43°C)

  • Measure SYM1 expression during heat shock response

Temperature Tolerance Comparison Data:
At 43°C, only 6 of 19 serotype D strains showed growth, compared to 16 of 19 serotype A strains, indicating significant differences in thermal adaptation mechanisms . This suggests proteins like SYM1 may play differential roles in thermal stress responses between serotypes.

How might SYM1 interact with known virulence factors in C. neoformans?

Researchers should investigate SYM1's potential relationship with:

  • Capsule formation and maintenance

  • Melanin production

  • Urease activity

  • Phospholipase secretion

Methodological approach:

  • Co-immunoprecipitation to identify interaction partners

  • RNA-seq of SYM1 mutants under virulence-inducing conditions

  • Comparative proteomics of secreted and cell-associated proteins

The protein translocation channel in C. neoformans' endoplasmic reticulum regulates virulence factor secretion . Determine if SYM1 interacts with secretory pathway components like Sbh1, which controls the entry of virulence factors into this pathway.

Does SYM1 contribute to pH adaptation in C. neoformans?

C. neoformans survival depends on its ability to adapt to varied pH environments during infection . To explore SYM1's potential role:

  • Measure SYM1 expression across pH gradients (pH 4-8)

  • Test growth of SYM1 mutants at different pH values

  • Compare phenotypes to other pH adaptation genes like SCP1

  • Analyze intracellular pH homeostasis in SYM1 mutants

SCP1 deletion results in growth inhibition at pH 8 . Similar phenotypic analysis with SYM1 mutants would reveal whether these genes function in related or distinct pH adaptation pathways.

How can transcriptomic analysis inform SYM1 function during host infection?

RNA-Seq approaches can elucidate SYM1's role during infection:

  • Compare transcriptomes of wild-type and SYM1 mutants during macrophage interactions

  • Analyze SYM1 expression in tissue culture medium at 37°C with 5% CO₂ (mimicking host conditions)

  • Identify co-regulated genes in the SYM1 regulon

Consider the genomic context revealed through C. neoformans transcriptome analysis, which identified over 40,000 introns and 1,197 miscRNAs that might regulate gene expression . Examine whether SYM1 is subject to post-transcriptional regulation through these mechanisms.

What methods can determine if SYM1 affects blood-brain barrier crossing?

C. neoformans crosses the blood-brain barrier to cause meningoencephalitis . To investigate SYM1's potential role:

  • In vitro blood-brain barrier models:

    • Human brain microvascular endothelial cell (HBMEC) transwell cultures

    • Measure transmigration of wild-type vs. SYM1 mutants

  • In vivo approaches:

    • Murine infection models with wild-type and SYM1 mutants

    • Quantify fungal burden in brain tissue

    • Assess histopathological changes

  • Molecular interactions:

    • Identify potential interactions between SYM1 and host cells

    • Evaluate expression changes in cell adhesion molecules

How might post-translational modifications affect SYM1 function?

Investigate potential post-translational modifications (PTMs) of SYM1:

  • Phosphoproteomic analysis to identify phosphorylation sites

  • Site-directed mutagenesis of putative modification sites

  • Functional analysis of PTM-mimicking mutants

How does SYM1 compare between environmental and clinical isolates of C. neoformans?

Conduct comparative analysis:

  • Sequence SYM1 genes from diverse isolates representing:

    • Environmental sources (soil, pigeon droppings)

    • Clinical isolates from different infection sites

    • Geographic regions with varying serotype prevalence

  • Functional complementation tests:

    • Cross-complementation between environmental and clinical alleles

    • Test for functional differences in stress response capacity

  • Expression analysis:

    • Compare promoter regions and regulatory elements

    • Measure expression levels in different isolates under standardized conditions

What can genomic analysis reveal about SYM1 evolution across Cryptococcus species?

Employ comparative genomics approaches:

  • Phylogenetic analysis of SYM1 across the Cryptococcus genus

  • Calculate selection pressures (dN/dS ratios) to identify evolutionary constraints

  • Compare genomic context and synteny of the SYM1 locus

Consider the genome analysis techniques that identified the chromosomal locations, centromeres, and origins of replication in C. neoformans var. grubii . Similar approaches could provide insights into the evolutionary history and functional conservation of SYM1.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.