Recombinant Cryptococcus neoformans var. neoformans serotype D Vacuolar ATPase assembly integral membrane protein VMA21 (VMA21)

Shipped with Ice Packs
In Stock

Description

Functional Role in V-ATPase Assembly

VMA21 facilitates the assembly of the V₀ domain of the V-ATPase in the ER membrane through:

  • Subunit Interaction: Binds the proteolipid subunits (c, c′, c′′) to form a rotor ring .

  • Escort Function: Transports the assembled V₀ complex to the Golgi, where it binds the V₁ sector to form the functional V-ATPase .

  • Quality Control: Ensures proper V₀ assembly by preventing premature interaction with the V₁ sector in the ER .

Structural Insights from CryoEM
Recent cryoEM studies reveal that VMA21 binds the V₀ complex in multiple orientations, stabilizing assembly intermediates. Its dissociation from V₀ occurs upon V₁ binding, enabling proton pumping in target compartments (e.g., vacuoles) .

Role in Fungal Pathogenesis

In Cryptococcus neoformans, VMA21 is essential for vacuolar biogenesis and survival under stress conditions. Knockout mutants exhibit defects in vacuolar fusion, capsule formation, and virulence .

Cancer Research

Overexpression of VMA21 in colorectal cancer (CRC) cells suppresses proliferation and tumor growth:

  • Mechanism: Inhibits colony formation in vitro and reduces tumor size in xenograft models .

  • Potential Biomarker: Elevated VMA21 expression correlates with favorable differentiation grades and disease-free survival in CRC patients .

Table 2: VMA21 in Colorectal Cancer

ParameterResult
Cell Lines TestedLoVo, SW620, RKO
Overexpression EffectReduced colony formation (p < 0.05)
In Vivo ImpactTumor weight reduction by 40–60% in xenograft models

Genetic Disorders

Mutations in VMA21 cause congenital disorders of glycosylation (CDG) and autophagic liver disease:

  • Clinical Features: Abnormal glycosylation, steatotic liver disease, and elevated LDL cholesterol .

  • Molecular Defects: Hypomorphic mutations reduce protein levels, impair V-ATPase activity, and lead to lysosomal dysfunction .

Comparative Analysis with Human VMA21

While structurally conserved, human VMA21 (UniProt ID: Q3ZAQ7) has distinct functional roles:

FeatureCryptococcus VMA21Human VMA21
Primary RoleV₀ assembly in ERV-ATPase assembly in ER
Disease LinkFungal pathogenesisAutophagic myopathy (XMEA)
Expression SystemE. coliMammalian cells

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes, and we will do our best to fulfill your requirements.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery information.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please notify us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing should be avoided. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be decided during production. If you have a preferred tag type, please inform us, and we will prioritize its development.
Synonyms
VMA21; CNBK3030; Vacuolar ATPase assembly integral membrane protein VMA21
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-104
Protein Length
full length protein
Species
Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) (Filobasidiella neoformans)
Target Names
VMA21
Target Protein Sequence
MSNRVSTGKMAMAPQESVQPAVLYKLVLFALLMAVVPIGTYFSTLNYLWDGASRCGFPSG LCSTTFAAISAIAAANLILVGYVVVAFREDAASRTGPLPEKKTS
Uniprot No.

Target Background

Function
VMA21 is essential for the assembly of the V0 complex of the vacuolar ATPase (V-ATPase) within the endoplasmic reticulum.
Database Links

KEGG: cnb:CNBK3030

Protein Families
VMA21 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein. Cytoplasmic vesicle, COPII-coated vesicle membrane; Multi-pass membrane protein.

Q&A

What is VMA21 and what is its fundamental role in V-ATPase assembly?

VMA21 is a chaperone protein essential for the assembly of Vacuolar H⁺-ATP complex (V-ATPase), a multisubunit protein complex required for acidification of intracellular compartments. VMA21 functions primarily in the endoplasmic reticulum (ER) where it facilitates the assembly of the V-ATPase V₀ domain . In the assembly process, VMA21 initially interacts with subunit c' of the V₀ domain, promoting the assembly of proteolipid subunits into a ring structure . After V₀ assembly is complete, VMA21 escorts the V₀ domain to the cis-Golgi, where it binds with the V₁ sector to form the functional V-ATPase . An important structural feature of VMA21 is its ER retention motif KKXX, which allows it to be transported back to the ER to participate in additional rounds of V₀ assembly .

How does VMA21 deficiency impact cellular functions?

VMA21 deficiency impairs V-ATPase assembly, leading to several downstream effects:

  • Reduced lysosomal acidification and impaired protease activation

  • Defective autophagy with accumulation of lipid droplets in autolysosomes

  • Endoplasmic reticulum stress activation

  • Sequestration of unesterified cholesterol in lysosomes

  • Activation of sterol response element-binding protein-mediated cholesterol synthesis pathways

These cellular dysfunctions manifest clinically in conditions such as X-linked myopathy with excessive autophagy (XMEA) and hepatic disorders characterized by steatosis and hypercholesterolemia .

What expression systems are optimal for producing recombinant VMA21 protein?

Recombinant VMA21 protein can be successfully expressed in prokaryotic systems, with E. coli being the preferred expression host for research applications. According to production protocols, full-length VMA21 protein (comprising amino acids 1-104) from Cryptococcus neoformans var. neoformans serotype D can be expressed with an N-terminal His tag in E. coli . This approach provides sufficient yields for biochemical and structural studies while maintaining protein functionality.

The expression methodology typically involves:

  • Cloning the VMA21 coding sequence into a suitable expression vector with an N-terminal His-tag

  • Transforming the construct into an E. coli expression strain

  • Inducing protein expression under optimized conditions

  • Purifying the recombinant protein using nickel affinity chromatography

This approach allows researchers to obtain purified VMA21 protein suitable for functional, structural, and interaction studies .

What methodologies are effective for studying VMA21 interactions with V-ATPase components?

Several complementary approaches have proven effective for investigating VMA21's interactions with V-ATPase components:

  • Co-immunoprecipitation assays: These can detect interactions between tagged VMA21 and V-ATPase subunits or assembly factors like ATP6AP2 and V₀ subunit ATP6V0C . This technique has revealed that missense mutations in VMA21 (R18G, D63G, and G91A) reduce interaction with both the assembly factor ATP6AP2 and V₀ subunit ATP6V0C .

  • Western blot analysis: This technique allows assessment of V-ATPase assembly by measuring steady-state levels of V₁ and V₀ subunits. Research has shown that while V₁ subunits ATP6V1D1 and ATP6V1B1/2 remain unaffected in VMA21-deficient cells, expression of V₀ subunits ATP6V0D1 and ATP6V0C is reduced, indicating impaired V₀ assembly in the ER .

  • Overexpression studies: Transient transfection of Myc-tagged VMA21 variants (both wild-type and mutants) in HEK293T cells allows for comparative analysis of protein interactions and assembly efficiency .

These methods collectively provide insights into how VMA21 facilitates V-ATPase assembly and how mutations affect this critical function.

How can zebrafish models advance our understanding of VMA21-related pathologies?

Zebrafish models have emerged as valuable tools for studying VMA21-related disorders. CRISPR-Cas9 gene editing has been used to generate loss-of-function mutations in zebrafish vma21, creating a model that phenocopies human X-linked myopathy with excessive autophagy (XMEA) . These vma21 mutant zebrafish exhibit:

  • Impaired motor function and reduced survival

  • Liver dysfunction with hepatic steatosis and cholestasis

  • Dysregulated autophagy indicated by:

    • Lysosomal de-acidification

    • Characteristic autophagic vacuoles in muscle fibers

    • Altered autophagic flux

    • Reduced lysosomal marker staining

Electron microscopy examination reveals that while wild-type myofibers show no vacuoles, vma21 mutants display identifiable vacuoles with electron-dense material and naked membranes within vacuole walls, consistent with autophagic vacuoles .

The zebrafish model also demonstrates significant lipid deposition in the livers of vma21 mutants compared to wild-type controls, indicating hepatic steatosis similar to that observed in human patients . Additionally, the model shows impaired bile flux, suggesting an underlying cholestatic liver phenotype that mirrors clinical observations in XMEA patients .

This zebrafish model has proven useful for evaluating potential therapeutic compounds, with initial studies showing that edaravone and LY294002 improve swim behavior and survival in vma21 mutants .

What molecular markers can be used to assess autophagic dysfunction in VMA21-deficient models?

Several molecular markers provide valuable insights into autophagic dysfunction in VMA21-deficient models:

MarkerObservation in VMA21 DeficiencyImplication
LC3I and LC3IIIncreased expression with decreased LC3II/LC3I ratioDisruption of autophagic flux
GFP-LC3-RFP-LC3ΔG ratioHigher GFP:RFP ratioLower autophagic flux
ATP6V0D1 and ATP6V0C (V₀ subunits)Reduced expressionImpaired V₀ assembly in ER
Lysosomal markersReduced stainingReduced lysosomal biogenesis

These markers collectively provide a comprehensive assessment of autophagic dysfunction resulting from VMA21 deficiency. For example, in vma21 mutant zebrafish, analysis of protein lysates showed a significant increase in LC3I and LC3II expression alongside a corresponding decrease in the LC3II/LC3I ratio, consistent with disruption of autophagic flux .

How do VMA21 mutations manifest in human disease?

VMA21 mutations lead to a spectrum of clinical manifestations, with two principal phenotypes identified:

  • X-linked myopathy with excessive autophagy (XMEA):

    • Childhood-onset autophagic vacuolar myopathy

    • Proximal muscle weakness

    • Progressive vacuolation in muscle tissue

    • Characteristic autophagic vacuoles in muscle fibers

  • Hepatic manifestations:

    • Chronic elevation of aminotransferases

    • Mild hypercholesterolemia with elevated LDL cholesterol

    • Hepatic steatosis (fatty liver)

    • Mild cholestasis

    • Abnormal glycosylation of hepatocyte-derived proteins

The severity and specific presentation depend on the nature of the VMA21 mutation. Genetic testing for VMA21 should be considered in patients presenting with a combination of liver symptoms and congenital disorders of glycosylation (CDG) .

What is the link between VMA21 deficiency and disorders of protein glycosylation?

VMA21 deficiency leads to abnormal protein glycosylation through disruption of the V-ATPase complex, which is essential for maintaining pH homeostasis in cellular compartments. In patients with VMA21 mutations, abnormal glycosylation of hepatocyte-derived proteins has been observed . This suggests that proper V-ATPase function is critical for the glycosylation process, likely through its role in maintaining optimal pH in the Golgi apparatus and other compartments where glycosylation occurs.

The clinical phenotype of abnormal glycosylation combined with liver symptoms should prompt clinicians to consider genetic testing for VMA21 and other V-ATPase assembly factors . This connection highlights the broad downstream effects of V-ATPase dysfunction beyond the well-established roles in lysosomal function and autophagy.

What is the role of VMA21 in colorectal cancer progression?

VMA21 appears to function as a tumor suppressor in colorectal cancer (CRC), with multiple lines of evidence supporting this role:

  • Clinical correlation: Higher VMA21 expression is significantly associated with:

    • Higher differentiation grade (p = 0.011)

    • Favorable disease-specific survival (DSS)

  • In vitro evidence: Overexpression of VMA21 in human colon cancer cell lines (LoVo and SW620) significantly suppresses colony formation ability .

  • In vivo evidence:

    • Ectopic expression of VMA21 inhibits CRC development in animal models

    • Xenograft tumors were significantly smaller in VMA21-overexpressing groups

    • Knockdown of VMA21 in RKO cells promoted CRC development

These findings suggest that VMA21 may represent a potential diagnostic and prognostic marker for CRC, particularly for patients with early-stage disease .

How can VMA21 expression be effectively measured in tumor samples?

Immunohistochemistry (IHC) has proven to be an effective method for measuring VMA21 expression in tumor samples. In colorectal cancer research, IHC scoring systems have been developed to quantify VMA21 expression levels .

Using the 97.5% quantile (175) of VMA21 in IHC scores from noncancerous specimens as a threshold, patients can be classified into VMA21-high (score >175) and VMA21-low (score ≤175) groups . An optimal IHC-score cut-off value of 215, as determined by maxstat software, has been shown to most efficiently distinguish differences in clinical outcomes .

Additional methodologies for measuring VMA21 expression include:

  • qRT-PCR: For measuring mRNA expression levels in cell lines and tissue samples

  • Western blotting: For protein expression analysis

  • RNA-seq: For transcriptome-wide expression analysis

These complementary approaches allow for comprehensive assessment of VMA21 expression in various experimental and clinical contexts.

How does VMA21 deficiency impact lysosomal function and lipid metabolism?

VMA21 deficiency disrupts lysosomal function and lipid metabolism through several interconnected mechanisms:

  • Impaired V-ATPase assembly: VMA21 deficiency reduces V₀ subunit expression and impairs assembly of the V-ATPase complex .

  • Reduced lysosomal acidification: The dysfunctional V-ATPase fails to properly acidify lysosomes, impairing the activity of acid hydrolases that require low pH .

  • Defective lipophagy: The impaired lysosomal acidification leads to defective degradation of lipid droplets through autophagy (lipophagy) .

  • Lipid accumulation: This results in the accumulation of lipid droplets within autolysosomes, as observed in hepatocytes from patients with VMA21 mutations .

  • Cholesterol sequestration: Unesterified cholesterol becomes sequestered in lysosomes, triggering activation of sterol response element-binding protein (SREBP)-mediated cholesterol synthesis pathways .

This cascade explains the clinical observation of steatosis (fatty liver) and hypercholesterolemia in patients with VMA21 mutations. The impaired lysosomal degradation capacity leads to accumulation of lipids that would normally be processed and recycled by functional lysosomes.

What approaches can be used to evaluate potential therapeutic interventions for VMA21-related disorders?

Several approaches have proven valuable for evaluating potential therapeutic interventions for VMA21-related disorders:

  • Zebrafish disease models: CRISPR-Cas9-engineered vma21 mutant zebrafish provide a platform for testing therapeutic compounds. Initial studies have shown that two drugs, edaravone and LY294002, improve swim behavior and survival in these models .

  • Cell-based assays: Fibroblasts from patients with VMA21 mutations can be used to test compounds that might restore lysosomal acidification or improve autophagy. Key readouts include:

    • Lysosomal pH measurement

    • Autophagic flux assays using LC3-II/LC3-I ratios

    • Lipid droplet quantification

    • V-ATPase assembly assessment

  • Molecular interaction studies: Compounds that might enhance residual VMA21 function or stabilize V-ATPase assembly can be screened using protein interaction assays .

These complementary approaches allow for comprehensive evaluation of potential therapeutic strategies targeting different aspects of VMA21-related pathophysiology, from molecular interactions to whole-organism phenotypes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.