Recombinant Cryptomeria japonica Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Cryptomeria japonica Apocytochrome f (petA)

Recombinant Cryptomeria japonica Apocytochrome f, commonly referred to as petA, is a protein derived from the Japanese cedar tree, Cryptomeria japonica. This protein plays a crucial role in the electron transport chain of photosynthesis, specifically in the photosystem I complex. The recombinant form of this protein is produced through genetic engineering techniques, allowing for its study and application in various fields such as biochemistry, molecular biology, and biotechnology.

Characteristics of Recombinant Cryptomeria japonica Apocytochrome f

  • Protein Structure: The apocytochrome f protein is characterized by its heme group, which is essential for its function in electron transfer. The amino acid sequence of the recombinant version is crucial for its stability and activity.

  • Gene Information: The gene encoding this protein is known as petA. The sequence of petA in Cryptomeria japonica has been documented, providing insights into its evolutionary significance and functional properties.

  • Storage and Stability: Recombinant proteins like petA are typically stored in Tris-based buffers with glycerol to maintain stability. They are best preserved at temperatures of -20°C or -80°C to prevent degradation.

Research Findings on Recombinant Cryptomeria japonica Apocytochrome f

Recent studies have focused on the biochemical properties and applications of recombinant petA. Key findings include:

  • Expression Systems: The recombinant protein can be expressed in various systems, including bacterial and plant systems, which allows for large-scale production.

  • Functional Analysis: Functional assays have demonstrated that recombinant petA retains its electron transfer capabilities, making it a valuable model for studying electron transport processes in photosynthesis.

  • Potential Applications: Due to its role in photosynthesis, recombinant apocytochrome f may have applications in bioengineering for improving plant productivity or developing biofuels.

Data Table: Properties of Recombinant Cryptomeria japonica Apocytochrome f

PropertyDetails
SpeciesCryptomeria japonica
Gene NamepetA
Uniprot IDB1VKB7
Molecular WeightApproximately 15 kDa
Storage Conditions-20°C or -80°C
Buffer CompositionTris-based buffer with 50% glycerol
Amino Acid Sequence LengthFull-length protein (36-321)

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
petA; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-321
Protein Length
Full Length of Mature Protein
Species
Cryptomeria japonica (Japanese cedar) (Cupressus japonica)
Target Names
petA
Target Protein Sequence
AYPIFAQQAYENPREATGRIVCANCHLAKKPVEIEVPQSVLPDTVFEAVVKIPYDKQIKQ VLANGKKGTLNVGAVLILPEGFELAPPDRIYPEIKEKIGDLYFQNYRPNQKNILIIGPVP GQKYSEIVFPILSPNPATNKAAHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNASATGKV SKIVRKEKGGYQITIDNPSDGRQVVDFVPPGPELLVSEGEFIKADQSLTNNPNVGGFGQE NAEIVLQDPLRVQGLLLFLASVVLAQIFLVLKKKQFEKVQLVEMNF
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex, mediating electron transfer between Photosystem II (PSII) and Photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

How does the genetic diversity of Cryptomeria japonica influence apocytochrome f expression and function?

Cryptomeria japonica demonstrates significant genetic differentiation across its natural range in Japan, with populations on the Pacific Ocean side being clearly distinct from those on the Japan Sea side. The genetic differentiation coefficient (FST = 0.05) indicates subtle but important genetic variations that likely affect protein expression patterns .

Studies have identified 208 outlier loci across the genome that show signatures of selection, with 43 of these associated with environmental variables. While the petA gene specifically wasn't highlighted in these studies, the genetic architecture of C. japonica includes four chromosomal regions with high linkage disequilibrium (LD) that may influence protein expression, including photosynthetic proteins like apocytochrome f .

The two main varieties of C. japonica (omote-sugi and ura-sugi/var. radicans) exhibit genetic differences that could theoretically lead to variations in apocytochrome f structure and function, potentially reflecting adaptation to different light conditions and photosynthetic requirements in their respective environments .

What are the optimal storage and reconstitution protocols for recombinant Cryptomeria japonica Apocytochrome f?

Storage Recommendations:

  • Store lyophilized protein at -20°C to -80°C upon receipt

  • Aliquot the protein to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

Reconstitution Protocol:

  • Briefly centrifuge the vial prior to opening to collect contents at the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (recommended 50%)

  • Aliquot for long-term storage at -20°C/-80°C

The reconstituted protein is stored in Tris/PBS-based buffer with 6% Trehalose at pH 8.0, which helps maintain stability during freeze-thaw cycles .

What expression systems are most effective for producing functional Cryptomeria japonica Apocytochrome f?

E. coli has been established as an effective heterologous expression system for Cryptomeria japonica Apocytochrome f . When selecting an expression system, researchers should consider:

  • Strain selection: BL21(DE3) or its derivatives are commonly used for membrane-associated proteins like apocytochrome f

  • Codon optimization: C. japonica utilizes different codon preferences than E. coli, making codon optimization essential for efficient expression

  • Fusion tags: The N-terminal His tag facilitates purification while minimizing interference with protein folding and function

  • Expression conditions: Lower temperatures (18-25°C) often yield better results for conifer proteins than standard 37°C induction

While E. coli is the predominant system, plant-based expression systems like tobacco or algal systems might provide more native-like post-translational modifications, though these approaches would require additional optimization steps not documented in the current literature for this specific protein.

What purification challenges are specific to Cryptomeria japonica Apocytochrome f, and how can they be addressed?

Purification of recombinant Cryptomeria japonica Apocytochrome f presents several challenges:

  • Membrane association: Native apocytochrome f associates with thylakoid membranes, making the recombinant version potentially difficult to solubilize

  • Heme incorporation: Functional cytochrome f requires proper heme incorporation, which may be incomplete in E. coli expression systems

  • Protein aggregation: The hydrophobic regions can lead to aggregation during concentration steps

Recommended purification strategy:

  • IMAC (Immobilized Metal Affinity Chromatography) using the His tag for initial capture

  • Addition of mild detergents (0.05-0.1% DDM or Triton X-100) to maintain solubility

  • Size exclusion chromatography as a polishing step to remove aggregates

  • Maintaining reducing conditions throughout purification to prevent disulfide cross-linking

The published protocols achieve >90% purity as determined by SDS-PAGE , which is suitable for most research applications. For structural studies, additional chromatography steps may be necessary.

How can researchers verify the functional integrity of purified recombinant Apocytochrome f?

Functional verification of recombinant Cryptomeria japonica Apocytochrome f should include:

  • Spectroscopic analysis: UV-visible spectroscopy to confirm proper heme incorporation, with characteristic absorption peaks at approximately 420 nm (Soret band), 520 nm, and 550 nm

  • Redox potential measurements: Using techniques like cyclic voltammetry or potentiometric titrations to confirm that the protein exhibits the expected redox properties

  • Electron transfer assays: In vitro reconstitution with plastocyanin to measure electron transfer rates

  • Structural assessment: Circular dichroism (CD) spectroscopy to verify secondary structure elements consistent with properly folded cytochrome f

  • Thermal stability analysis: Differential scanning calorimetry (DSC) or thermal shift assays to determine if the recombinant protein exhibits expected thermal stability

A properly folded and functional apocytochrome f should demonstrate electron transfer capabilities consistent with its role in the photosynthetic electron transport chain, though specific activity values for the C. japonica protein have not been reported in the provided literature.

How do genetic variants of Cryptomeria japonica Apocytochrome f correlate with adaptations to different environmental conditions?

The genetic differentiation observed in Cryptomeria japonica populations across Japan provides an excellent model for studying environmental adaptation of photosynthetic proteins. While specific variants of apocytochrome f have not been directly characterized, the genomic studies reveal important patterns:

  • Environmental correlation: Of the 208 outlier loci identified across the C. japonica genome, 43 show associations with environmental variables, suggesting adaptive significance

  • Geographic differentiation: Populations from different geographic regions (Pacific Ocean side vs. Japan Sea side) show genetic differentiation that likely reflects adaptation to different light and temperature regimes

  • Linkage disequilibrium clusters: Four genomic regions in linkage groups (LGs) 2, 7, 10, and 11 show particularly high linkage disequilibrium, suggesting these regions have been under selection

Population ComparisonGenetic DifferentiationEnvironmental Factors
Pacific vs. Japan SeaClear differentiationTemperature, precipitation patterns
Northern vs. SouthernClinal variationPhotoperiod, cold tolerance
Yakushima (isolated)Unique genetic featuresVolcanic soil, island isolation

The Yakushima population, being large, isolated, and peripheral, occupies a specific environment resulting from isolation combined with volcanic activity, potentially driving unique adaptations in photosynthetic proteins including apocytochrome f .

Research combining genomic data with protein functional assays would be valuable for linking specific apocytochrome f variants to photosynthetic adaptations across environmental gradients.

How can site-directed mutagenesis of recombinant Cryptomeria japonica Apocytochrome f enhance our understanding of electron transport mechanisms?

Site-directed mutagenesis offers powerful approaches for investigating structure-function relationships in apocytochrome f:

  • Heme coordination sites: Mutations of the conserved cysteine and histidine residues involved in heme coordination can reveal the specific contributions of these residues to redox potential and electron transfer rates

  • Interaction surfaces: Altering residues at the predicted interface with plastocyanin can elucidate the molecular determinants of protein-protein recognition and electron transfer efficiency

  • Environmental adaptation sites: Targeting amino acids that differ between C. japonica populations from different environments can test hypotheses about adaptive modifications

  • Stability engineering: Introducing mutations to enhance stability without compromising function could produce variants with improved properties for biotechnological applications

Potential key residues for mutagenesis include the conserved CXXCH motif for heme binding, surface lysine residues involved in electrostatic interactions with plastocyanin, and residues unique to C. japonica compared to other plant species.

What experimental designs are most effective for studying the electron transfer properties of recombinant Cryptomeria japonica Apocytochrome f?

Optimal experimental designs for studying electron transfer properties include:

  • Laser flash photolysis: This technique allows time-resolved measurements of electron transfer between purified apocytochrome f and its redox partners, typically on microsecond to millisecond timescales

  • Electrochemical approaches:

    • Protein film voltammetry on modified electrodes

    • Spectroelectrochemistry combining optical measurements with controlled redox potential

    • Mediated electrochemistry using small molecule mediators

  • Reconstituted systems: Incorporation of purified apocytochrome f into liposomes with other components of the electron transport chain for measuring coupled electron transfer

  • Comparative kinetics: Parallel experiments with apocytochrome f from different C. japonica populations to identify potential adaptations in electron transfer efficiency

Experimental conditions should mimic physiological parameters:

  • pH range: 7.0-8.0 (stromal pH during photosynthesis)

  • Temperature series: 5-35°C (reflecting the natural temperature range experienced by C. japonica)

  • Salt concentrations: 50-200 mM (mimicking stromal ionic strength)

What are the critical quality control parameters for ensuring reproducible research with recombinant Apocytochrome f?

To ensure reproducible research with recombinant Cryptomeria japonica Apocytochrome f, researchers should implement these quality control measures:

  • Protein purity assessment:

    • SDS-PAGE with minimum accepted purity >90%

    • Mass spectrometry to confirm protein identity and detect modifications

  • Functional verification:

    • UV-visible spectroscopy to confirm heme incorporation

    • Redox potential measurements within expected range

  • Stability monitoring:

    • Dynamic light scattering to detect aggregation

    • Activity assays before and after storage to confirm retention of function

  • Batch consistency:

    • Documentation of expression conditions and yields

    • Standardized purification protocols with defined acceptance criteria

  • Storage standardization:

    • Aliquoting to avoid freeze-thaw cycles

    • Addition of 5-50% glycerol for long-term storage

    • Storage at -20°C/-80°C for maintenance of stability

Implementation of these quality control measures will significantly improve reproducibility across different laboratories and experimental conditions.

How can researchers integrate genomic and protein-level studies of Cryptomeria japonica Apocytochrome f?

Integration of genomic and protein-level studies represents an advanced research approach that can provide comprehensive insights:

  • Population genomics to protein variation pipeline:

    • Identify SNPs in the petA gene across C. japonica populations

    • Express and characterize variant proteins

    • Correlate functional differences with environmental parameters

  • Structure-guided genomic analysis:

    • Map genetic variants onto protein structural models

    • Predict functional effects using computational approaches

    • Test predictions experimentally with recombinant variants

  • Multi-omics integration:

    • Combine genomic data with transcriptomics to assess expression levels

    • Add proteomics to identify post-translational modifications

    • Include metabolomics to link to photosynthetic output

  • Ecological genomics approach:

    • Sample populations across environmental gradients

    • Identify adaptive genetic variants in petA and related genes

    • Test fitness effects of variants in controlled environments

This integrated approach would benefit from the extensive genomic resources already available for C. japonica, including SNP markers and linkage maps , while extending these to understand the functional consequences at the protein level.

What emerging technologies could advance our understanding of Cryptomeria japonica Apocytochrome f structure and function?

Several cutting-edge technologies show promise for advancing research on C. japonica apocytochrome f:

  • Cryo-electron microscopy: The revolution in resolution achieved with cryo-EM makes it increasingly feasible to determine structures of plant membrane proteins like apocytochrome f in near-native states

  • Single-molecule techniques:

    • Optical tweezers for measuring protein-protein interaction forces

    • Single-molecule FRET for detecting conformational changes during electron transfer

    • Nanopore analysis for studying protein dynamics

  • Advanced computational approaches:

    • Machine learning for predicting function from sequence

    • Molecular dynamics simulations with polarizable force fields for more accurate modeling of electron transfer

    • Quantum mechanical/molecular mechanical (QM/MM) methods for studying electron transfer mechanisms

  • Genome editing in conifers:

    • CRISPR/Cas9 adaptation for C. japonica to create knockouts or precise mutations

    • Development of conifer protoplast systems for transient expression studies

These technologies could overcome current limitations in understanding the structure-function relationships of this important photosynthetic protein.

How might climate change impact the function and evolution of Apocytochrome f in Cryptomeria japonica populations?

Climate change presents both challenges and research opportunities related to apocytochrome f function:

  • Temperature adaptation:

    • Increased temperatures may select for variants with enhanced thermal stability

    • Changes in kinetic properties may be necessary to maintain electron transport efficiency under elevated temperatures

  • Population genomics predictions:

    • The existing genetic differentiation across environmental gradients provides a model for predicting responses to climate change

    • Isolated populations like Yakushima may contain genetic variants pre-adapted to warmer conditions

  • Experimental approaches:

    • Reciprocal transplant experiments combined with protein functional assays

    • Laboratory evolution under simulated future climate conditions

    • Comparison of electron transfer efficiency across temperature ranges for proteins from different populations

  • Conservation implications:

    • Identifying populations with adaptive variants for assisted migration programs

    • Preserving genetic diversity to maintain adaptive potential for photosynthetic efficiency

Given that C. japonica has adapted to diverse environments across Japan , studying the functional diversity of its photosynthetic proteins could provide insights into climate adaptation mechanisms in long-lived forest trees.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.