Recombinant Cryptomeria japonica ATP synthase subunit b, chloroplastic (atpF)

What is Cryptomeria japonica ATP synthase subunit b, and what is its role in plant physiology?

ATP synthase subunit b (atpF) in Cryptomeria japonica is a chloroplastic protein that forms part of the ATP synthase complex, which is essential for energy production in chloroplasts. This protein is encoded by the atpF gene and constitutes part of the Fo domain of the ATP synthase complex . The complete amino acid sequence consists of 181 amino acids with characteristic hydrophobic regions that facilitate membrane integration .

ATP synthase functions as a rotary motor that couples proton translocation across the thylakoid membrane with ATP synthesis. Specifically, subunit b acts as a peripheral stalk component that links the membrane-embedded Fo sector with the catalytic F1 portion of the complex . This stator function is crucial for preventing the F1 domain from rotating with the central stalk during catalysis, thereby enabling the conformational changes necessary for ATP synthesis .

How does C. japonica ATP synthase subunit b differ from homologous proteins in other species?

Cryptomeria japonica ATP synthase subunit b shares structural and functional similarities with homologous proteins found in other species, but with several distinctive features. Based on available sequence data, the protein consists of 181 amino acids with the sequence MKNVTDSFISLSSAEGFGLNTNILETNIINLSVVLGVLIYFGKGVLSNLLDNRKQKISSTIQSSEELCKGAANQLEQARARLREVERRVREIRVNGYSQIQQEKNDLINVASINLKQLENLKNETIHLEQERVIELVQKQISYQAVQRALGTLNSRLNSELHLRTIEHNIDLLLAMKNIT .

When compared to ATP synthase subunit b from model organisms, the C. japonica protein demonstrates unique adaptations that may reflect its evolutionary history and specialized function in gymnosperm chloroplasts. While the core functional domains are conserved across species, variations in certain regions likely contribute to species-specific differences in complex assembly, stability, or regulatory properties.

Unlike bacterial homologs, the chloroplastic ATP synthase in plants like C. japonica contains additional subunits that provide regulatory capabilities adapted to the photosynthetic lifestyle . Comparative analysis with other conifer species would be particularly valuable but is currently limited by the available genomic and proteomic data for this group of plants.

What experimental systems are available for studying recombinant C. japonica atpF protein?

Researchers have several experimental systems available for studying the recombinant C. japonica atpF protein:

• E. coli expression system: Currently, the most established method for producing the recombinant protein utilizes an in vitro E. coli expression system with N-terminal 10xHis-tagged constructs . This system allows for efficient production and subsequent purification of the protein.

• Plant tissue culture systems: Given the importance of C. japonica in forestry, embryogenic culture systems have been developed that could potentially be adapted for protein expression studies. These include established protocols for embryogenic cell line (ECL) maintenance and proliferation that might be modified for protein expression .

• Heterologous expression in model plants: While not specifically documented for atpF, techniques developed for C. japonica propagation could potentially be adapted for expressing the protein in model plant systems, offering a more native-like environment for functional studies .

• Reconstitution systems: Based on methodologies used for other ATP synthase components, it may be possible to develop reconstitution systems where the purified protein is integrated into artificial membranes or liposomes to study its functional properties .

The choice of experimental system depends on the specific research questions being addressed, with each approach offering different advantages in terms of protein yield, post-translational modifications, and functional context.

What are the optimal conditions for expression and purification of recombinant C. japonica atpF?

The optimal conditions for expression and purification of recombinant Cryptomeria japonica ATP synthase subunit b involve several critical parameters:

Expression System and Conditions:

• The recommended expression system is an in vitro E. coli platform, which has been successfully used to produce the full-length protein (181 amino acids) .

• Expression constructs should include an N-terminal 10xHis-tag to facilitate purification .

• Expression is typically induced under standard conditions for E. coli recombinant protein production, with induction parameters adjusted to favor soluble protein expression.

Purification Protocol:

• Initial capture is performed using immobilized metal affinity chromatography (IMAC) leveraging the N-terminal 10xHis-tag.

• The purified protein can be provided in either liquid form or as a lyophilized powder .

• For liquid formulations, a Tris/PBS-based buffer system at pH 8.0 containing 6% trehalose serves as an effective stabilizer .

Storage Recommendations:

• Short-term storage: The protein in liquid form has a shelf life of approximately 6 months at -20°C to -80°C .

• Long-term storage: Lyophilized preparations can be stored for up to 12 months at -20°C to -80°C .

• Aliquoting is essential for multiple use scenarios to avoid repeated freeze-thaw cycles .

Critical Considerations:

• As a membrane-associated protein, special attention should be paid to maintaining the structural integrity during purification.

• The addition of appropriate detergents or lipid environments may be necessary depending on the intended experimental applications.

• Verification of proper folding and activity should be performed using functional assays specific to ATP synthase components.

How can researchers assess the functional activity of the recombinant C. japonica atpF protein?

Assessing the functional activity of recombinant C. japonica atpF protein requires specialized approaches that address its role as part of the ATP synthase complex. Here are methodological guidelines for functional assessment:

Membrane Integration Assays:

• Liposome reconstitution experiments to verify the protein's ability to integrate into lipid bilayers.

• Proteoliposome formation with subsequent assessment of membrane association via density gradient centrifugation.

• Fluorescence-based assays to monitor protein-membrane interactions using labeled protein or lipid components.

Complex Assembly Assessment:

• Co-immunoprecipitation with other ATP synthase components to verify subunit interaction capabilities.

• Blue Native PAGE analysis to determine if the recombinant protein can incorporate into higher-order complexes when combined with other subunits .

• Analytical ultracentrifugation to characterize complex formation and stability.

Functional Coupling Experiments:

• Proton translocation assays using pH-sensitive fluorescent dyes in reconstituted systems.

• ATP synthesis/hydrolysis measurements in reconstituted proteoliposomes containing the complete or partial ATP synthase complex.

• Electron microscopy to visualize complex formation and structural arrangements.

In Vivo Complementation:

• Expression in ATP synthase-deficient bacterial or yeast strains to assess functional complementation.

• Chloroplast transformation systems could potentially be used to test function in a more native context, though this is technically challenging.

These methodological approaches provide a comprehensive framework for evaluating whether the recombinant protein maintains its native functional properties and can participate appropriately in ATP synthase complex assembly and function.

How can researchers design experiments to study the structure-function relationship of C. japonica atpF protein in context of ATP synthase complex?

Designing experiments to elucidate the structure-function relationship of C. japonica atpF requires sophisticated approaches that integrate structural biology, biochemistry, and molecular genetics. Here is a comprehensive experimental framework:

Site-Directed Mutagenesis Strategy:

• Identify conserved regions through sequence alignment with ATP synthase subunit b from diverse species.

• Design a systematic mutagenesis screen targeting:

  • Transmembrane domains implicated in c-ring interaction

  • Interface regions that contact other stator components

  • Potential regulatory sites

Structural Analysis Approaches:

• X-ray crystallography of the isolated protein, building on methodologies successfully employed for related ATP synthase components .

• Cryo-electron microscopy of reconstituted subcomplexes containing atpF.

• Solution NMR studies of specific domains or peptide fragments.

• Cross-linking mass spectrometry to map interaction sites with partner proteins.

Functional Reconstitution Experiments:

• Develop a system for stepwise reconstitution of minimal functional units:

  Component Combination	Expected Function	Assessment Method
  atpF + c-ring	Membrane integration	Liposome association
  atpF + peripheral stalk	Stator assembly	Blue Native PAGE
  atpF + F1 components	Structural coupling	ATP hydrolysis assay
  Complete reconstitution	ATP synthesis	Proton gradient-driven ATP production

• Compare wild-type protein with selected mutants in each reconstitution scenario.

In Silico Approach Integration:

• Molecular dynamics simulations to predict conformational changes during catalytic cycle.

• Homology modeling based on available structures from closely related species.

• Quantum mechanics/molecular mechanics (QM/MM) calculations for proton translocation mechanisms.

Application of Advanced Biophysical Techniques:

• Single-molecule FRET to monitor conformational changes during rotation.

• Atomic force microscopy to visualize topography of reconstituted complexes.

• Hydrogen-deuterium exchange mass spectrometry to probe dynamic structural regions.

This multidisciplinary approach enables researchers to connect structural features to specific functional aspects, providing insights into the unique adaptations of C. japonica ATP synthase within the evolutionary context of gymnosperm energy metabolism.

What are the challenges and solutions in studying the interaction between C. japonica atpF and other ATP synthase components?

Studying interactions between C. japonica atpF and other ATP synthase components presents several significant challenges along with potential methodological solutions:

Challenges and Solutions Matrix:

Advanced Interaction Studies:

• Surface Plasmon Resonance (SPR):

  • Immobilize atpF on sensor chips using the His-tag

  • Measure binding kinetics with other purified components

  • Determine affinity constants for various interaction partners

• Bimolecular Fluorescence Complementation (BiFC):

  • Design split fluorescent protein fusions to atpF and potential partners

  • Express in plant protoplast systems

  • Visualize interaction through fluorescence reconstitution

• Proteomics-Based Approaches:

  • Stable isotope labeling of components

  • Cross-linking followed by mass spectrometry

  • Identification of interaction interfaces at amino acid resolution

• Cryo-EM of Partial Complexes:

  • Focus on subassemblies containing atpF

  • Image classification to identify different conformational states

  • Structural determination of interaction architectures

Researchers must consider the biological context of C. japonica as a gymnosperm, which may present unique evolutionary adaptations in ATP synthase architecture compared to better-studied angiosperm or bacterial systems . The integration of complementary techniques is essential to overcome individual methodological limitations and build a comprehensive interaction model.

How can C. japonica atpF research contribute to understanding chloroplast evolution and adaptation in gymnosperms?

Research on Cryptomeria japonica ATP synthase subunit b offers unique opportunities to advance our understanding of chloroplast evolution and gymnosperm adaptation through several interconnected research avenues:

Evolutionary Trajectory Analysis:
The ATP synthase complex represents a highly conserved molecular machine with origins dating back to the earliest life forms. Detailed characterization of C. japonica atpF allows researchers to trace evolutionary modifications specific to the gymnosperm lineage . By comparing sequence conservation, structural adaptations, and functional properties with those of other plant groups (angiosperms, ferns, mosses) and prokaryotic ancestors, researchers can reconstruct the evolutionary trajectory of this essential bioenergetic complex and identify gymnosperm-specific innovations.

Environmental Adaptation Signatures:
As Japan's national tree, C. japonica has adapted to specific environmental conditions . The ATP synthase complex directly interfaces with energy production and thus may contain adaptations that reflect:

• Temperature adaptation mechanisms in temperate climates

• Seasonal photosynthetic adjustments in evergreen conifers

• Stress response capabilities that shape resilience

Functional Genomics Framework:
Integration of atpF research with broader genomic and transcriptomic data can provide insights into:

Chloroplast Engineering Applications:
Understanding the structure-function relationship of C. japonica atpF contributes to potential applications in chloroplast engineering. As research advances on creating male-sterile plants (MSPs) of C. japonica to address pollen allergy issues , knowledge of chloroplast function becomes increasingly relevant. Engineered modifications to bioenergetic pathways could potentially contribute to:

• Enhanced photosynthetic efficiency

• Improved growth characteristics for forestry applications

• Stress resilience traits for climate adaptation

Methodological Template for Gymnosperm Research:
The protocols developed for studying C. japonica atpF can serve as a template for investigating other gymnosperm species, particularly those with economic or ecological importance. The integration of molecular techniques with propagation methods like somatic embryogenesis creates powerful research platforms for previously understudied plant groups.

By positioning C. japonica atpF research within this broader evolutionary and ecological context, researchers can extract insights that extend far beyond the immediate molecular characterization, contributing to our fundamental understanding of plant adaptation and energy metabolism evolution.

What are the recommended protocols for analyzing potential post-translational modifications of C. japonica atpF?

Analysis of post-translational modifications (PTMs) in Cryptomeria japonica ATP synthase subunit b requires a systematic approach combining multiple complementary techniques. Here is a comprehensive protocol framework:

Sample Preparation Protocols:

• Protein Extraction and Enrichment:

  • Extract total protein from chloroplast-enriched fractions of C. japonica tissues

  • Alternatively, use recombinant protein expressed in E. coli system with N-terminal 10xHis-tag

  • Perform affinity purification using anti-His antibodies or ATP synthase complex-specific antibodies

  • Consider parallel analysis of native and recombinant protein to identify expression system-specific modifications

• Proteolytic Digestion Options:

  • Perform parallel digestions with multiple proteases (trypsin, chymotrypsin, Glu-C)

  • Use optimized digestion buffers containing 6M urea for membrane protein solubilization

  • Consider limited proteolysis approaches to preserve structural context

Mass Spectrometry-Based PTM Identification:

• LC-MS/MS Analysis Strategy:

  • Employ high-resolution instruments (Orbitrap or Q-TOF)

  • Use data-dependent acquisition (DDA) with inclusion lists for predicted modification sites

  • Implement parallel reaction monitoring (PRM) for targeted analysis of specific modifications

  • Apply data-independent acquisition (DIA) for comprehensive modification mapping

• PTM-Specific Enrichment Techniques:

  • Phosphorylation: TiO₂ or IMAC enrichment

  • Glycosylation: Lectin affinity chromatography or hydrazide chemistry

  • Acetylation: Anti-acetyllysine antibody enrichment

  • Oxidative modifications: Diagonal chromatography

• Data Analysis Parameters:

  • Search against C. japonica protein database with variable modification options

  • Implement false discovery rate control at both peptide and PTM site levels

  • Validate using site-determining ions and diagnostic fragmentation patterns

  • Quantify modification stoichiometry using label-free or isotope labeling approaches

Complementary Non-MS Techniques:

• Site-Specific Antibody Development:

  • Generate antibodies against predicted modification sites

  • Apply in Western blotting and immunoprecipitation studies

  • Use for tissue-specific and developmental stage analysis

• Functional Impact Assessment:

  • Generate site-directed mutants mimicking or preventing specific modifications

  • Analyze effects on protein-protein interactions within the ATP synthase complex

  • Evaluate impact on ATP synthase assembly and function

This comprehensive approach provides a robust framework for characterizing the PTM landscape of C. japonica atpF, which may reveal important regulatory mechanisms specific to gymnosperm chloroplast ATP synthase function and adaptation.

How can researchers develop expression systems for C. japonica atpF that maintain native protein folding and functionality?

Developing expression systems for Cryptomeria japonica ATP synthase subunit b that preserve native folding and functionality requires careful consideration of multiple factors. Here is a methodological framework addressing this challenge:

1. Expression Host Selection Strategy:

2. Vector Design Elements:

• Incorporate the complete atpF sequence (181 amino acids)

• Include chloroplast targeting sequences when using eukaryotic hosts

• Design constructs with removable fusion tags beyond the N-terminal 10xHis tag

• Consider inducible promoter systems for toxic protein regulation

3. Co-expression Strategies:

• Co-express with chloroplast-specific chaperones

• Include other ATP synthase components for co-folding opportunities

• Express with lipid-modifying enzymes to create appropriate membrane environment

4. Membrane Mimetic Approaches:

• Supplement expression media with specific lipids found in chloroplast membranes

• Use nanodiscs or amphipols for post-extraction stabilization

• Develop reconstitution protocols with thylakoid-mimicking liposomes

5. Folding Verification Methods:

• Circular dichroism spectroscopy to assess secondary structure

• Limited proteolysis to probe correctly folded conformations

• Thermal shift assays to determine stability profiles

• Functional reconstitution with other ATP synthase components

6. Optimization Workflow:

• Start with the established E. coli system as baseline

• Systematically modify expression parameters (temperature, induction time, media composition)

• Implement parallel expression in multiple systems

• Evaluate both structural integrity and functional activity

• Select optimal system based on quality metrics rather than yield alone

This comprehensive approach addresses the critical challenge of producing properly folded C. japonica atpF protein, enabling downstream structural and functional studies that accurately reflect native properties.

What specialized techniques can be used to study C. japonica atpF in the context of whole-plant physiology and stress responses?

Investigating Cryptomeria japonica ATP synthase subunit b in the context of whole-plant physiology and stress responses requires integrating molecular approaches with plant physiological techniques. The following specialized methodologies enable researchers to connect protein-level mechanisms to organism-level responses:

In Vivo Imaging and Biosensor Applications:

• Fluorescent Protein Fusion Systems:

  • Generate atpF-fluorescent protein fusions for localization studies

  • Combine with chloroplast markers to study dynamic distributions

  • Implement in transgenic C. japonica systems using established somatic embryogenesis protocols

• FRET-Based ATP Sensors:

  • Deploy genetically encoded ATP sensors in chloroplasts

  • Correlate ATP synthase activity with local ATP concentrations

  • Monitor real-time responses to environmental stressors

Physiological Phenotyping Platforms:

• Integrated Chlorophyll Fluorescence Analysis:

  • Measure photosystem II efficiency (Fv/Fm) under varied conditions

  • Assess electron transport rates as indicator of ATP synthase function

  • Implement light response curves to evaluate energetic coupling

• Gas Exchange Measurements:

  • Quantify photosynthetic parameters (CO₂ assimilation, transpiration)

  • Calculate energy conversion efficiencies

  • Correlate with ATP synthase activity under stress conditions

Tissue-Specific Expression Profiling:

• Laser Capture Microdissection:

  • Isolate specific tissue types from C. japonica needles/stems

  • Extract RNA for tissue-specific transcriptome analysis

  • Correlate atpF expression with tissue-specific metabolism

• Single-Cell Technologies:

  • Develop protoplast isolation protocols for C. japonica

  • Implement single-cell RNA-seq to identify cell-type specific regulation

  • Correlate with protein localization data

Stress Response Experimental Design:

Genetically Modified Research Systems:

• RNA Interference Approaches:

  • Develop atpF-targeted RNAi constructs

  • Create transgenic lines with reduced expression

  • Assess physiological consequences of ATP synthase deficiency

• CRISPR-Based Strategies:

  • Design specific gRNAs targeting the atpF gene

  • Generate plants with modified atpF variants

  • Analyze whole-plant phenotypes under various conditions

These integrated approaches enable researchers to connect molecular mechanisms involving C. japonica atpF to whole-plant physiological responses, particularly in the context of environmental adaptation and stress response mechanisms relevant to this economically important forestry species .

How might research on C. japonica atpF contribute to biotechnological applications in forestry and conservation?

Research on Cryptomeria japonica ATP synthase subunit b presents several promising avenues for biotechnological applications in forestry and conservation, connecting fundamental molecular understanding with practical applications:

Enhanced Biomass Production Strategies:

ATP synthase functions at the core of energy metabolism, directly influencing growth potential and biomass accumulation. Understanding the structure-function relationship of C. japonica atpF could enable:

• Identification of natural variants with enhanced ATP production efficiency

• Development of molecular markers for selecting trees with optimal energy conversion capabilities

• Potential genetic modifications to improve photosynthetic output under suboptimal conditions

These approaches could help address the growing demand for sustainable forestry products from Japan's most important forestry tree species, which currently covers 44% of the country's artificial forest area .

Pollen-Free Tree Development:

The significant public health challenge posed by C. japonica pollen allergies affecting approximately 40% of Japan's population creates a direct application pathway:

• Integration of atpF research with ongoing male-sterile plant (MSP) development programs

• Exploration of energy metabolism differences in reproductive tissues

• Potential targeting of chloroplast function in pollen development

The established methodologies for propagation of pollen-free Japanese cedar could be further enhanced through molecular understanding of energy requirements during reproductive development .

Climate Adaptation Enhancement:

As climate change presents increasing challenges to forest ecosystems, understanding the molecular basis of stress resilience becomes critical:

• Characterization of atpF responses to temperature extremes, drought, and high light conditions

• Identification of stress-tolerant variants for breeding programs

• Development of molecular diagnostics to assess forest health and stress status

The detailed propagation systems already established for C. japonica provide an excellent platform for implementing biotechnological advances derived from atpF research.

Conservation Applications Matrix:

The well-established propagation protocols for C. japonica, including somatic embryogenesis and marker-assisted selection , provide effective pathways for translating molecular insights into practical forestry and conservation applications.

What are the potential research intersections between C. japonica atpF studies and renewable energy research?

The study of Cryptomeria japonica ATP synthase subunit b intersects with renewable energy research through several innovative pathways that leverage the fundamental understanding of bioenergetic systems for applied energy solutions:

Biomimetic Energy Conversion Systems:

ATP synthase represents one of nature's most efficient rotary nanomotors, converting proton gradients into chemical energy with remarkable efficiency. Research on C. japonica atpF can inform:

• Design principles for artificial molecular motors based on gymnosperm-specific adaptations

• Development of nanoscale energy harvesting devices inspired by the ATP synthase architecture

• Creation of biomimetic membranes with embedded protein complexes for energy conversion

These approaches could potentially overcome efficiency limitations in current renewable energy technologies by adopting strategies refined through millions of years of evolutionary optimization.

Biohybrid Solar Energy Applications:

Chloroplast ATP synthase operates within the photosynthetic apparatus, coupling light-driven electron transport to ATP production. Research intersections include:

• Integration of ATP synthase components with artificial photosynthetic systems

• Development of semi-biological solar cells utilizing principles from chloroplast energy conversion

• Engineering of optimized energy transfer pathways based on gymnosperm adaptations

The unique evolutionary position of C. japonica as a gymnosperm may reveal alternative energy conversion strategies distinct from more commonly studied angiosperm systems .

Biofuel Production Enhancement:

Understanding energy metabolism in woody species like C. japonica has direct relevance to biofuel research:

• Identification of rate-limiting steps in ATP production that influence biomass accumulation

• Engineering of energy utilization efficiency to maximize carbon fixation

• Development of molecular tools to assess metabolic status in biofuel feedstock species

These applications leverage the economic importance of C. japonica as a major forestry species while extending its potential contribution to renewable energy solutions.

Research Integration Framework:

The intersection of fundamental research on C. japonica atpF with renewable energy applications represents a promising frontier where evolutionary adaptations in natural energy systems can inform technological innovations for sustainable energy solutions.

What interdisciplinary approaches could advance our understanding of C. japonica atpF in relation to climate change adaptation?

Understanding Cryptomeria japonica ATP synthase subunit b in the context of climate change adaptation requires innovative interdisciplinary approaches that connect molecular mechanisms to ecosystem responses. The following framework integrates multiple research domains to address this complex challenge:

Molecular Ecology Integration:

• Landscape Genomics Approach:

  • Sample C. japonica populations across climate gradients in Japan

  • Sequence atpF and related genes to identify adaptive variants

  • Correlate genetic variants with climate parameters and physiological performance

  • Develop predictive models for population responses to changing conditions

• Experimental Climate Manipulation:

  • Establish common garden experiments with genotyped C. japonica variants

  • Implement controlled climate change scenarios (temperature, precipitation, CO₂)

  • Monitor ATP synthase function and energy metabolism parameters

  • Connect molecular responses to whole-plant performance metrics

Temporal Dimension Analysis:

• Paleoecological Reconstruction:

  • Analyze ancient C. japonica DNA from preserved specimens

  • Reconstruct historical atpF sequence evolution

  • Correlate sequence changes with historical climate shifts

  • Model evolutionary trajectories under future climate scenarios

• Real-Time Monitoring Systems:

  • Develop field-deployable sensors for chloroplast function assessment

  • Implement continuous monitoring across seasonal and annual cycles

  • Correlate energy metabolism patterns with climate variables

  • Create early warning systems for stress response thresholds

Multi-Omics Integration Framework:

Cross-Species Comparative Analysis:

• Evaluate ATP synthase adaptations across conifer species with different climate niches

• Compare C. japonica responses with model species to identify gymnosperm-specific mechanisms

• Develop evolutionary models for energy metabolism adaptation under climate change

Translational Research Applications:

• Assisted Migration Support:

  • Identify ATP synthase variants adapted to warmer/drier conditions

  • Inform provenance selection for reforestation under climate change

  • Develop molecular markers for climate-adapted germplasm

• Forest Management Guidelines:

  • Translate molecular insights into practical management recommendations

  • Optimize silvicultural practices based on energetic requirements

  • Develop stress mitigation strategies informed by ATP synthase responses

This interdisciplinary framework connects molecular mechanisms involving C. japonica atpF to ecosystem-level climate adaptation, providing both fundamental insights and practical applications for managing this economically crucial forestry species in the face of ongoing climate change.