Recombinant Cryptomeria japonica Chloroplast envelope membrane protein (cemA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
cemA; Chloroplast envelope membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-261
Protein Length
full length protein
Species
Cryptomeria japonica (Japanese cedar) (Cupressus japonica)
Target Names
cemA
Target Protein Sequence
MDLIPRSIIRTLFRFWTELTSQSSSLAIHELEVAKYKTFASLQYLTCLIVLPWAISISLQ NSLESWVTNWWNTGQSKKIFDYLQEENAIRKFEKIEELFLLEIMVKDYSETPSQDIRVEM QKKMIQLVKIYNQDCIHIISHLLANLIGLVLLSVCLILGKKKLGILNSWIQEVFYSLSDT MKAFSILLVTDLCIGFHSPHGWELMINWIFENYGFAHNERIISGLVSTFPVILDTIFKYW IFRRLNRISPSLVVIYHSMNE
Uniprot No.

Target Background

Function
This protein may be involved in proton extrusion and indirectly promotes efficient inorganic carbon uptake into chloroplasts.
Protein Families
Cema family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.

Q&A

What expression systems are most appropriate for recombinant cemA production?

For recombinant cemA production, bacterial expression systems (particularly E. coli) provide adequate yields for initial characterization, though they may lack appropriate post-translational modifications. Evidence from related research on C. japonica proteins indicates that E. coli expression systems have been successfully employed for other recombinant proteins from this species . For more structurally accurate cemA, plant-based expression systems are preferable. Studies with other C. japonica recombinant proteins demonstrate that Agrobacterium-mediated transformation has been effectively used in this species . When selecting an expression system, researchers should consider that membrane proteins often require specialized conditions to maintain native conformation. Expression timing should be optimized through pilot studies using different induction periods (24h, 48h, and 72h) and temperatures (16°C, 25°C, 37°C).

What purification strategies yield functional recombinant cemA?

A multi-step purification approach is essential for obtaining functional recombinant cemA. Begin with mild detergent solubilization (recommended detergents: DDM, LDAO, or OG at concentrations of 0.5-2%) followed by affinity chromatography using His-tag or GST-tag systems. Research on similar membrane proteins suggests that native PAGE analysis can verify protein integrity post-purification. Critical factors affecting purification success include buffer composition (test phosphate, Tris, and HEPES buffers at pH ranges 6.5-8.0) and salt concentration (typically 100-500 mM NaCl). For maximum stability during purification, maintain samples at 4°C and include protease inhibitors to prevent degradation. Similar approaches have been successfully applied to other recombinant proteins from C. japonica in allergen research .

How does cemA function relate to chloroplast development in Cryptomeria japonica?

The relationship between cemA and chloroplast development appears to be fundamental, as evidenced by parallel studies targeting other chloroplast genes in C. japonica. Research using CRISPR/Cas9 to target the magnesium chelatase subunit I (CjChlI) gene in C. japonica resulted in altered chlorophyll biosynthesis, producing green, pale green, and albino phenotypes . This suggests that targeted modification of chloroplast-related genes significantly impacts photosynthetic capacity. For cemA specifically, examining its expression patterns during different developmental stages and under various environmental conditions would provide insights into its regulatory role in chloroplast biogenesis. Spatial and temporal expression analyses should be conducted using techniques such as RT-qPCR, in situ hybridization, and immunolocalization to map cemA's contribution to organelle development.

What molecular techniques are most effective for studying cemA gene regulation?

Based on successful applications in C. japonica research, the following molecular approaches have proven effective for studying gene regulation:

TechniqueApplicationAdvantagesConsiderations for cemA
CRISPR/Cas9Gene knockout/knockdownPrecise targeting, allows biallelic mutationsSuccessfully used in C. japonica with efficiency rates of 3.1-41.4%
RT-qPCRExpression quantificationHigh sensitivity, quantitativeRequires careful reference gene selection
Promoter analysisRegulatory element identificationIdentifies cis-acting elementsSeveral C. japonica promoters have been characterized (e.g., PcUbi)
Chromatin immunoprecipitationProtein-DNA interactionsIdentifies transcription factor bindingRequires specific antibodies
RNA-SeqTranscriptome-wide analysisComprehensive gene expression profileSuccessfully applied in conifer studies

For cemA specifically, the CRISPR/Cas9 system utilizing the PcUbi promoter (shown to be highly active in C. japonica embryogenic tissue) would be recommended for gene editing experiments, as this promoter demonstrated superior activity in transient expression assays .

How can protein-protein interactions of cemA be effectively characterized?

To characterize cemA protein-protein interactions, employ a multi-method approach combining: (1) Co-immunoprecipitation with cemA-specific antibodies followed by mass spectrometry; (2) Yeast two-hybrid screening using cemA as bait against a C. japonica cDNA library; (3) Bimolecular fluorescence complementation to verify interactions in planta; and (4) Surface plasmon resonance to determine binding kinetics of identified partners. For membrane proteins like cemA, specialized approaches such as membrane yeast two-hybrid or split-ubiquitin systems may yield better results than conventional methods. When designing these experiments, consider that cemA likely interacts with both chloroplast and nuclear-encoded proteins, necessitating sub-cellular fractionation techniques. Similar approaches have been successfully applied to characterize protein interactions in conifers, though specifically designed protocols may be needed to accommodate the unique properties of C. japonica cells.

What strategies improve recombinant cemA solubility and stability?

Improving recombinant cemA solubility requires a comprehensive approach targeting expression, extraction, and storage conditions. For expression optimization, reduce induction temperature to 16-18°C and use lower inducer concentrations over extended periods (24-48 hours). During extraction, employ a sequential solubilization approach starting with mild detergents (0.5% DDM or LDAO) before attempting stronger solubilization agents. For long-term storage, glycerol supplementation (10-20%) and flash-freezing in liquid nitrogen have proven effective for membrane proteins. Fusion partners that enhance solubility (MBP, SUMO, or thioredoxin) can significantly improve yields of soluble protein. Additional stabilizing agents to consider include specific lipids that might be present in the native chloroplast membrane environment. Similar recombinant protein work with C. japonica allergens demonstrated that PEGylation significantly improved protein stability and reduced aggregation .

How can transgenic approaches be optimized for studying cemA function in vivo?

Based on successful transformation protocols developed for C. japonica, the following optimized approaches should be considered:

  • Use Agrobacterium-mediated transformation of embryogenic tissue, which has proven successful for C. japonica with appropriate selection markers (kanamycin resistance) .

  • Select an appropriate promoter for transgene expression - the PcUbi promoter showed superior activity in C. japonica tissues compared to seven other tested promoters .

  • For CRISPR/Cas9 applications, utilize the modified vector system (such as pBFGE1) that incorporates the Z. mays ubiquitin promoter, which works effectively in C. japonica .

  • Screen transformants using both molecular techniques (PCR, Southern blotting) and phenotypic analyses, as chimeric mutants may display different phenotypes within the same plant .

  • Monitor transgene expression through multiple generations, as stability of expression is critical for long-term studies.

The transformation efficiency reported for C. japonica embryogenic tissue lines ranges from moderate to high when using optimized protocols , with successful generation of biallelic mutants .

How should researchers interpret variable expression data for cemA?

When confronted with variable cemA expression data, implement a systematic analytical framework: First, normalize expression using multiple reference genes validated specifically for C. japonica tissues (at least 3 reference genes are recommended). Apply appropriate statistical tests based on data distribution - non-parametric tests like Mann-Whitney U are often more appropriate for gene expression data that doesn't follow normal distribution. Consider developmental stage and tissue-specific variations, as chloroplast proteins often show distinct expression patterns across plant tissues and developmental phases. Technical replicates should address PCR efficiency variations, while biological replicates should account for plant-to-plant variability. When using transcriptomic approaches, validate key findings with RT-qPCR. Research on other C. japonica genes demonstrates significant variation in expression patterns depending on tissue type and developmental stage, necessitating careful experimental design and thorough statistical analysis .

What are common pitfalls in cemA research and how can they be avoided?

Common pitfalls in cemA research include:

  • Protein aggregation during purification: Address by screening multiple detergents (DDM, LDAO, OG) at varying concentrations (0.5-2%) and implementing a step-wise solubilization approach.

  • Non-specific antibody binding: Develop cemA antibodies against unique epitopes, perform extensive validation using knockout/knockdown controls, and pre-absorb sera against related proteins.

  • Inconsistent transformation efficiency: Optimize Agrobacterium-mediated transformation protocols specifically for C. japonica embryogenic tissue, maintaining strict temperature and humidity controls during co-cultivation .

  • Chimeric transformants: Implement early screening at the callus stage using molecular markers, followed by single-cell isolation to establish homogeneous lines .

  • Variable phenotypes: Document comprehensive phenotypic data across multiple growth conditions to distinguish cemA-specific effects from environmental influences.

Research with C. japonica has demonstrated that careful optimization of transformation protocols can significantly improve experimental outcomes, with studies reporting discrimination rates of 100% for specific genotypes when using marker-assisted selection combined with somatic embryogenesis .

How can researchers distinguish between direct and indirect effects in cemA modification studies?

To distinguish between direct and indirect effects in cemA modification studies, implement a comprehensive approach combining: (1) Multiple independent transgenic/mutant lines to identify consistent phenotypes; (2) Complementation studies restoring wild-type cemA function to confirm causality; (3) Tissue-specific or inducible expression systems to temporal control of cemA modification; (4) Transcriptomic and proteomic analyses to map downstream effects; and (5) Metabolomic profiling to identify metabolic changes. Early developmental stages should be carefully analyzed, as chloroplast proteins often influence multiple downstream pathways. When interpreting results, consider that somatic embryogenesis, a common propagation method for C. japonica, may itself introduce epigenetic variations that could confound phenotypic analyses . The CRISPR/Cas9 system has been successfully implemented in C. japonica with various targeting efficiencies (ranging from 3.1-41.4%), providing a valuable tool for creating precise genetic modifications to study cemA function .

How might cemA research contribute to addressing Cryptomeria japonica pollen allergies?

The investigation of cemA may indirectly contribute to addressing C. japonica pollen allergies through advanced understanding of chloroplast development and its relationship to reproductive biology. While cemA itself is not an allergen like Cry j 1 and Cry j 2 (the major allergenic proteins causing Japanese cedar pollinosis), research on chloroplast proteins contributes to our fundamental understanding of C. japonica biology. Current allergen-specific immunotherapy approaches using recombinant fusion proteins of Cry j 1 and Cry j 2 show promise in attenuating allergic responses, with PEGylated fusion proteins demonstrating significant reduction in allergen-specific IgE levels . Complementary strategies focusing on developing pollen-free variants through genetic modification of genes like CjACOS5 have successfully produced male-sterile phenotypes . Future cemA research could potentially reveal relationships between chloroplast function and pollen development, providing additional targets for developing hypoallergenic or pollen-free varieties through precision breeding approaches.

What integrative approaches would advance our understanding of cemA in conifer biology?

Advancing our understanding of cemA requires integrative approaches combining genomics, proteomics, and systems biology: Implement comparative genomics across conifer species to identify evolutionary conservation patterns of cemA; utilize spatial transcriptomics and proteomics to map cemA expression in different tissues and developmental stages; apply network analysis to position cemA within chloroplast-nuclear signaling pathways; and develop conifer-specific computational models predicting cemA function based on structure and interactome data. CRISPR/Cas9 technology, which has been successfully optimized for C. japonica , offers powerful tools for functional validation. The development of somatic embryogenesis protocols for C. japonica (producing 243.6 ± 163.6 cotyledonary embryos per plate with germination rates of 87.1 ± 11.9% ) provides efficient platforms for generating transformed lines for these studies. Integration of these approaches would create a comprehensive understanding of cemA's role in conifer biology and potentially reveal novel applications in forestry and biotechnology.

How could cemA research inform sustainable forestry practices with Cryptomeria japonica?

Research on cemA and other chloroplast proteins could significantly inform sustainable forestry practices through several pathways: First, understanding chloroplast function may lead to trees with enhanced photosynthetic efficiency and improved carbon sequestration capacity. Second, knowledge of chloroplast-related stress responses could help develop varieties with enhanced resilience to climate change. Third, insights into chloroplast biology could inform breeding programs targeting specific wood properties for sustainable timber production. The development of male-sterile lines through genetic modification already demonstrates practical applications of molecular research in addressing C. japonica pollen allergies, a significant public health concern in Japan affecting approximately 40% of the population . Similar molecular approaches focusing on cemA and related chloroplast proteins could potentially contribute to developing varieties with improved growth characteristics, disease resistance, or environmental adaptation, supporting Japan's forestry sector while addressing environmental and public health concerns.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.