Recombinant Cryptomeria japonica NAD (P)H-quinone oxidoreductase subunit 3, chloroplastic

What is NAD(P)H-quinone oxidoreductase subunit 3 from Cryptomeria japonica?

NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic (ndhC) is a membrane-bound protein component of the NAD(P)H dehydrogenase complex found in the chloroplasts of Cryptomeria japonica (Japanese cedar). This protein functions as part of the electron transport chain in chloroplasts, catalyzing the oxidation of NAD(P)H and the reduction of plastoquinone. The full-length protein consists of 120 amino acids with a sequence beginning with MYLFSEYDTFWIYLSISSLIPILAFSISRS, and its UniProt accession number is B1VKF4 . The protein is classified as an oxidoreductase with an EC number of 1.6.5.- and is encoded by the ndhC gene in the chloroplast genome.

What structural characteristics define this enzyme?

NAD(P)H-quinone oxidoreductase subunit 3 is characterized by a predominantly hydrophobic amino acid sequence consistent with its role as a membrane-spanning protein in the thylakoid membrane. Although no crystal structure has been determined specifically for subunit 3, related structures such as subunit K from the same organism have been computationally modeled using AlphaFold, with a global pLDDT score of 79.95, indicating confident structural predictions . Based on sequence analysis, the protein contains multiple transmembrane domains that anchor it within the membrane, allowing it to participate in electron transfer across the lipid bilayer. The amino acid sequence MYLFSEYDTFWIYLSISSLIPILAFSISRSLAPISKGAEKATSYESGIEPMGDTWIQFRIRYYMFALVFVVFDVETVFLYPWAMSFDILGLFTFIEAFIFVIILIVGLVYAWRKGALEWS reveals regions of hydrophobicity consistent with membrane integration .

How does this enzyme function within the chloroplast electron transport system?

The NAD(P)H-quinone oxidoreductase complex functions in a pathway of nonphotochemical plastoquinone (PQ) reduction that runs parallel to cyclic and chlororespiratory electron flow . This enzyme catalyzes the transfer of electrons from NAD(P)H to plastoquinone, contributing to the maintenance of the redox balance within the chloroplast. Research involving related NAD(P)H dehydrogenase components has demonstrated that these enzymes can reduce plastoquinone contained in plastoglobules, specialized lipid droplets in the chloroplast . In vitro studies have shown that purified plastoglobules can function as a quinone-containing substrate and accept electrons from NADPH and recombinant enzyme, supporting this functional role . This electron transfer activity is critical for various physiological processes, including adaptation to varying light conditions and stress responses.

What are the optimal storage conditions for the recombinant protein?

For optimal preservation of recombinant NAD(P)H-quinone oxidoreductase subunit 3, the protein should be stored in a Tris-based buffer containing 50% glycerol at -20°C . For extended storage periods, conservation at -80°C is recommended. To maintain protein integrity, repeated freeze-thaw cycles should be avoided as they can lead to protein denaturation and loss of activity. Working aliquots may be stored at 4°C for up to one week to minimize freeze-thaw damage . The storage buffer is specifically optimized for this protein to maintain its native conformation and enzymatic activity.

How does this enzyme compare to homologous proteins in other plant species?

NAD(P)H-quinone oxidoreductase subunit 3 from Cryptomeria japonica shares significant sequence homology with equivalent subunits from other plant species, particularly gymnosperms. While specific comparative data for subunit 3 is limited in the provided search results, related research on subunit K from the same complex shows that these proteins are part of a highly conserved system across photosynthetic organisms . The function of this enzyme in nonphotochemical plastoquinone reduction appears to be conserved across plant species, though species-specific variations in regulatory mechanisms may exist. Comparative genomic analyses have identified this protein as part of the standard complement of chloroplast-encoded genes in land plants, highlighting its evolutionary conservation and functional importance.

What are the established protocols for expressing and purifying this recombinant protein?

Expression and purification of recombinant NAD(P)H-quinone oxidoreductase subunit 3 requires specialized approaches due to its hydrophobic nature and membrane association. The recommended protocol involves:

• Expression system selection: Heterologous expression in E. coli using specialized strains designed for membrane protein expression, such as C41(DE3) or C43(DE3).

• Vector design: Incorporation of appropriate fusion tags (typically determined during the production process) to facilitate purification without compromising protein activity .

• Culture conditions: Growth at lower temperatures (16-25°C) after induction to enhance proper folding.

• Extraction: Solubilization using mild detergents such as n-dodecyl β-D-maltoside (DDM) or digitonin to maintain native conformation.

• Purification: Sequential chromatography steps, typically involving:

  • Affinity chromatography based on the fusion tag

  • Size exclusion chromatography to separate aggregates

  • Ion exchange chromatography for final polishing

• Quality control: Assessment of purity by SDS-PAGE and functionality through activity assays measuring electron transfer from NAD(P)H to quinone acceptors.

This methodology enables the production of functionally active protein suitable for biochemical and structural studies.

How can researchers accurately measure the electron transfer activity of this enzyme?

The electron transfer activity of NAD(P)H-quinone oxidoreductase subunit 3 can be measured using several complementary approaches:

• Spectrophotometric assays: Monitoring the oxidation of NAD(P)H at 340 nm or the reduction of artificial electron acceptors such as decyl-plastoquinone or 2,6-dichlorophenolindophenol (DCPIP).

• Oxygen consumption measurements: Using oxygen electrodes to monitor oxygen-dependent reactions coupled to the enzyme activity.

• In vitro reconstitution assays: As demonstrated with related enzymes, purified plastoglobules can serve as a physiological quinone-containing substrate, accepting electrons from NADPH in the presence of the recombinant enzyme . This approach allows for measurement of activity in a more native-like environment.

• Fluorescence-based methods: Utilizing fluorescent probes sensitive to changes in redox state to monitor electron transfer in real-time.

• Electrochemical techniques: Protein film voltammetry to directly measure electron transfer rates to and from electrodes.

For quantitative analysis, researchers should establish standard curves using known concentrations of purified enzyme and substrates, while including appropriate positive and negative controls to account for background activity and non-enzymatic reactions.

What approaches are effective for studying protein-protein interactions within the NAD(P)H dehydrogenase complex?

Investigating the interactions between subunit 3 and other components of the NAD(P)H dehydrogenase complex requires specialized techniques suitable for membrane protein complexes:

• Co-immunoprecipitation (Co-IP): Using antibodies against one subunit to pull down interaction partners, followed by identification through mass spectrometry.

• Blue native PAGE: Separating intact protein complexes under non-denaturing conditions to preserve native interactions.

• Cross-linking coupled with mass spectrometry (XL-MS): Using chemical cross-linkers to stabilize transient interactions, followed by digestion and identification of cross-linked peptides to map interaction interfaces.

• Förster resonance energy transfer (FRET): Tagging different subunits with complementary fluorophores to detect proximity-dependent energy transfer in vivo or in vitro.

• Bimolecular fluorescence complementation (BiFC): Expressing protein fragments fused to complementary fragments of a fluorescent protein to visualize interactions in living cells.

• Surface plasmon resonance (SPR): Measuring binding kinetics between immobilized subunit 3 and other purified components of the complex.

• Cryo-electron microscopy: Resolving the structure of the intact complex to determine the spatial arrangement of all subunits, including subunit 3.

These approaches provide complementary information about the composition, stoichiometry, and dynamics of the complex, enabling researchers to build comprehensive models of its functional architecture.

What site-directed mutagenesis strategies have been employed to study the function of conserved residues?

While specific mutagenesis studies on NAD(P)H-quinone oxidoreductase subunit 3 from Cryptomeria japonica are not detailed in the provided search results, effective approaches for similar membrane-bound oxidoreductases include:

• Conservation analysis: Identifying highly conserved residues across species through multiple sequence alignment, which can be prioritized for mutagenesis.

• Structural hotspot targeting: Based on available structural models or homology to related proteins, focusing on residues predicted to be involved in:

  • Substrate binding

  • Cofactor coordination

  • Proton transfer pathways

  • Subunit interfaces

• Systematic mutagenesis strategy:

  Mutation Type	Purpose	Experimental Readout
  Alanine scanning	Identify essential residues	Activity assays, complex assembly
  Conservative substitutions	Probe specific chemical properties	Substrate specificity, kinetic parameters
  Charge reversal	Test electrostatic interactions	Subunit binding, electron transfer rates
  Cysteine substitution	Enable site-specific labeling	Accessibility, conformational changes

• Functional assessment: Measuring the impact of mutations on:

  • Enzyme kinetics (Km, kcat, substrate specificity)

  • Complex assembly

  • Localization within the chloroplast

  • Plant phenotype (when expressed in vivo)

This systematic approach allows researchers to build a comprehensive understanding of structure-function relationships within this complex enzyme system.

How does the enzyme perform in non-aqueous reaction systems for potential biotechnological applications?

The application of NAD(P)H-quinone oxidoreductase in non-aqueous systems represents an emerging area of research with potential biotechnological implications. While specific data for subunit 3 from Cryptomeria japonica is not directly addressed in the search results, research on related oxidoreductases provides valuable insights:

Oxidoreductases tolerant to organic solvents are highly significant for both scientific research and biomanufacturing applications . Non-aqueous biocatalysis offers several advantages:

• Enhanced substrate solubility: Effective solvation of hydrophobic reactants

• Reduced substrate/product inhibition: Particularly important for quinone-based reactions

• Simplified product recovery: Easier separation of enzyme from reaction products

• Thermodynamic equilibrium shifts: Favorable reaction directionality in specific solvent systems

• Structural adaptations required: The entire protein structure must be modified to maintain functionality in organic solvents, which may decrease catalytic efficiency .

• Stability considerations: Membrane proteins typically require specific lipid environments or detergent micelles to maintain their native conformation.

For researchers exploring these applications, strategies from extremophile oxidoreductases can be applied:

• Analysis of amino acid interaction networks to understand solvent tolerance mechanisms

• Conservation and co-evolution analysis to guide enzyme engineering

• Incorporation of specific adaptations found in halophilic enzymes, which often display organic solvent tolerance

What are the cutting-edge approaches for studying the regulation of gene expression for this enzyme?

Advanced methodologies for investigating the regulation of ndhC gene expression in Cryptomeria japonica include:

• Genome-wide expression profiling:

  • RNA-Seq under various environmental conditions (light intensity, temperature, drought)

  • ChIP-Seq to identify transcription factors and regulatory elements

  • ATAC-Seq to map open chromatin regions associated with active transcription

• Promoter analysis techniques:

  • Reporter gene assays to identify regulatory regions

  • DNA footprinting to pinpoint transcription factor binding sites

  • Electrophoretic mobility shift assays (EMSA) to characterize protein-DNA interactions

• Epigenetic regulation assessment:

  • Bisulfite sequencing to map DNA methylation patterns

  • ChIP-Seq targeting histone modifications

  • Chromosome conformation capture techniques to identify long-range regulatory interactions

• Post-transcriptional regulation:

  • RNA immunoprecipitation to identify RNA-binding proteins

  • Ribosome profiling to assess translational efficiency

  • miRNA target analysis to identify potential post-transcriptional regulators

• In vivo regulation studies:

  • CRISPR-Cas9 mediated editing of regulatory elements

  • Inducible expression systems to control temporal expression

  • Tissue-specific promoters to examine spatial regulation

These approaches provide complementary insights into the complex regulatory networks controlling the expression of this important chloroplast enzyme under different physiological and stress conditions.