Recombinant Cryptomeria japonica NAD (P)H-quinone oxidoreductase subunit 4L, chloroplastic

Shipped with Ice Packs
In Stock

Description

Comparative Analysis with Barley NDH Subunit 4L

FeatureCryptomeria japonica Subunit 4LBarley Subunit 4L
Length100 residues99 residues
Molecular Weight11.2 kDa11.2 kDa
Sequence Identity~65% (based on alignment)UniProt ID: Q6ENA5 (barley homolog)

Functional Role in Chloroplasts

The NDH complex, including subunit 4L, enables cyclic electron flow around Photosystem I (PSI), critical for ATP synthesis and stress adaptation . Key functions:

  • Electron Transfer: Shuttles electrons from NAD(P)H to plastoquinone, reducing reactive oxygen species (ROS) .

  • Proton Translocation: Couples redox reactions to proton gradient formation, driving ATP synthase .

  • Stress Response: Stabilizes photosynthesis under drought and high-light conditions by maintaining redox balance .

Production and Purification

The recombinant protein is optimized for high yield and purity (>85% by SDS-PAGE) :

  1. Cloning: Full-length ndhE gene (encoding subunit 4L) inserted into a bacterial vector.

  2. Expression: Induced in E. coli under optimized conditions.

  3. Purification: Affinity chromatography via His-tag, followed by buffer exchange into Tris-glycerol formulations .

Stability Profile

ConditionStability
Lyophilized12 months at -20°C/-80°C
Liquid6 months at -20°C/-80°C
Repeated ThawingNot recommended; aliquot for single use

Research Applications

  • Enzyme Kinetics: Used to study NAD(P)H oxidation rates and inhibitor binding (e.g., dicoumarol analogs) .

  • Structural Biology: Crystallization trials to resolve NDH complex architecture .

  • Biotechnology: Engineered into stress-tolerant crops via chloroplast transformation .

Challenges and Future Directions

  • Structural Flexibility: Subunit 4L’s conformational dynamics during electron transfer remain poorly resolved .

  • Species-Specific Variations: Functional disparities between Cryptomeria and barley NDH complexes warrant further study .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference when placing your order. We will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please contact your local distributor.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this need in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
ndhE; NAD(PH-quinone oxidoreductase subunit 4L, chloroplastic; NAD(PH dehydrogenase subunit 4L; NADH-plastoquinone oxidoreductase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Cryptomeria japonica (Japanese cedar) (Cupressus japonica)
Target Names
ndhE
Target Protein Sequence
MLEHALILGAYLFSIGIYGLVTSRNMVKALMCLELILNAVNLNLVTFSNFFDSRQVKGDI FSIFVIAIAAAEAAIGLAIVLAIYRNRKSTRIDQFNLSKW
Uniprot No.

Target Background

Function
NDH (NAD(P)H-quinone oxidoreductase) shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and potentially in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. It couples the redox reaction to proton translocation, thereby conserving the redox energy in a proton gradient.
Protein Families
Complex I subunit 4L family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is NAD(P)H-quinone oxidoreductase subunit 4L from Cryptomeria japonica?

NAD(P)H-quinone oxidoreductase subunit 4L (ndhE) is a chloroplastic protein found in Cryptomeria japonica (Japanese cedar). It functions as part of the NAD(P)H dehydrogenase complex involved in electron transport chains within the chloroplast. This protein has an EC classification of 1.6.5.- and is also known as NAD(P)H dehydrogenase subunit 4L or NADH-plastoquinone oxidoreductase subunit 4L . It plays a critical role in chloroplast energy metabolism and is part of the photosynthetic apparatus in this gymnosperm species.

What are the optimal storage conditions for the recombinant protein?

For optimal stability and activity retention, the recombinant NAD(P)H-quinone oxidoreductase subunit 4L should be stored in a Tris-based buffer with 50% glycerol. Short-term storage (up to one week) can be maintained at 4°C, while long-term storage requires -20°C or preferably -80°C for extended preservation . It is crucial to avoid repeated freeze-thaw cycles, as these can significantly compromise protein integrity and activity. When working with the protein, it is advisable to aliquot the stock solution to minimize freeze-thaw cycles.

What purification strategies are most effective for this recombinant protein?

The most effective purification strategy depends on the expression system and tag used. Since the tag type is determined during the production process , researchers should adapt their purification protocol accordingly. For His-tagged variants, immobilized metal affinity chromatography (IMAC) using Ni-NTA or Co-NTA resins is effective. For GST-tagged proteins, glutathione sepharose affinity chromatography would be appropriate. Following initial affinity purification, size exclusion chromatography can improve purity, especially for structural or enzyme kinetic studies.

What expression systems are most suitable for producing this protein?

While the search results don't explicitly mention expression systems, recombinant proteins from chloroplastic origin like NAD(P)H-quinone oxidoreductase subunit 4L typically present challenges due to their membrane-associated nature. E. coli expression systems with modifications for membrane proteins (such as C41(DE3) or C43(DE3) strains) can be effective. For studies requiring post-translational modifications, eukaryotic systems such as insect cells (using baculovirus) might provide better functional expression. The choice should align with research objectives, balancing between yield, functional activity, and downstream applications.

How can this protein be used in allergen research related to Japanese cedar pollinosis?

While NAD(P)H-quinone oxidoreductase subunit 4L itself is not identified as an allergen, research on Cryptomeria japonica involves significant allergen studies. Researchers can use this recombinant protein as a control when investigating cedar pollen allergens like Cry j 4, which was discovered as a counterpart allergen to Cha o 3 in Japanese cedar pollen . When designing allergen studies, it's important to compare immunoreactivity profiles between known allergens and non-allergenic proteins from the same species to understand specificity in immune responses and potential cross-reactivity.

What techniques can be used to study the protein's role in photosynthesis?

To investigate this protein's role in photosynthesis, researchers can employ multiple complementary approaches:

  • Oxygen evolution measurements: Using Clark-type electrodes to measure photosynthetic efficiency in samples with native vs. altered protein levels

  • Chlorophyll fluorescence analysis: Employing PAM fluorometry to assess photosystem II efficiency and electron transport rates

  • Blue-native PAGE: For studying intact protein complexes and their associations within the chloroplast membrane

  • Infrared micro-spectroscopy: This technique has been successfully used to study water retention in Cryptomeria japonica leaves and could be adapted to study changes associated with NAD(P)H-quinone oxidoreductase activity

The protein's function can also be studied under varying environmental conditions, such as the elevated CO2 and O3 conditions described in research on Cryptomeria japonica .

How do mutations in the gene encoding this protein affect plant stress responses?

Mutations in ndhE (the gene encoding NAD(P)H-quinone oxidoreductase subunit 4L) potentially impact plant stress responses, particularly oxidative stress handling. Since this protein participates in electron transport, alterations could affect:

  • Reactive oxygen species (ROS) management: Compromised function may lead to increased ROS accumulation

  • Photoinhibition resistance: Altered capacity to deal with excess light energy

  • Drought response mechanisms: Changes in water-use efficiency, particularly in tall trees where water transport is already challenged

Research methodology should include:

  • CRISPR/Cas9 gene editing to create specific mutations

  • Transcriptome analysis comparing wild-type and mutant plants under stress conditions

  • Physiological measurements of photosynthetic parameters and water relations

  • Biochemical assays of antioxidant enzyme activities

What is the evolutionary significance of this protein across gymnosperm species?

The evolutionary significance of NAD(P)H-quinone oxidoreductase subunit 4L can be studied through phylogenetic analysis comparing sequences across gymnosperm species. Research indicates conservation of certain molecular mechanisms between Cryptomeria japonica and other species. For example, studies on male strobilus development showed that when the CjMALE1 promoter from C. japonica was introduced into Arabidopsis, gene expression occurred in the same spatiotemporal pattern as in C. japonica, suggesting highly conserved transcriptional regulatory systems .

To investigate evolutionary aspects of NAD(P)H-quinone oxidoreductase subunit 4L, researchers should:

  • Perform comprehensive sequence alignments across diverse plant lineages

  • Analyze selection pressures on different protein domains

  • Conduct functional complementation studies across species

  • Examine changes in protein-protein interactions within the complex

How can researchers interpret enzyme kinetic data for this oxidoreductase?

Interpreting enzyme kinetic data for NAD(P)H-quinone oxidoreductase requires consideration of its membrane-bound nature and involvement in electron transfer chains. When analyzing kinetic parameters:

  • Substrate affinity (Km): Should be measured for both NAD(P)H and various quinone acceptors

  • Maximum velocity (Vmax): Must be normalized to active protein concentration, challenging for membrane proteins

  • Inhibition patterns: Analyze competitive vs. non-competitive inhibition profiles

  • pH and temperature optima: Critical for understanding physiological relevance

  • Effect of lipid environment: Reconstitution in different lipid compositions may significantly alter activity

Data presentation should include Michaelis-Menten plots, Lineweaver-Burk transformations, and inhibition constant calculations. Statistical analysis should account for the typically higher variability observed with membrane protein assays.

What controls and validation steps are essential when using antibodies against this protein?

When using antibodies against NAD(P)H-quinone oxidoreductase subunit 4L, rigorous validation is crucial:

  • Specificity controls:

    • Western blot analysis using the recombinant protein as a positive control

    • Pre-absorption tests with purified protein

    • Testing against tissues/cells known to lack the protein

  • Cross-reactivity assessment:

    • Testing against closely related proteins, particularly NAD(P)H-quinone oxidoreductase subunit 6

    • Examination across multiple plant species if studying conservation

  • Application-specific validation:

    • For immunoprecipitation: Verify protein recovery through mass spectrometry

    • For immunohistochemistry: Include tissue-processing controls

    • For ELISA: Establish standard curves using purified recombinant protein

  • Reproducibility verification:

    • Testing multiple antibody lots

    • Comparing monoclonal and polyclonal antibodies when available

How does the chloroplastic NAD(P)H-quinone oxidoreductase from C. japonica compare to similar proteins in angiosperms?

Comparative analysis between the chloroplastic NAD(P)H-quinone oxidoreductase from Cryptomeria japonica and angiosperm counterparts reveals both conservation and adaptation. While core catalytic domains remain conserved, gymnosperm-specific modifications may exist to accommodate their unique photosynthetic requirements. Research methodologies should include:

  • Structural alignment of protein sequences with attention to functional domains

  • Enzyme activity assays under standardized conditions

  • Complementation studies in mutant backgrounds

  • Analysis of protein-protein interaction networks

These comparisons provide insights into the evolution of photosynthetic machinery across plant lineages and may identify gymnosperm-specific adaptations that contribute to their success in diverse ecological niches.

What similarities and differences exist between NAD(P)H-quinone oxidoreductase subunit 4L and subunit 6?

NAD(P)H-quinone oxidoreductase subunits 4L and 6 from Cryptomeria japonica show distinct characteristics despite functioning within the same complex:

FeatureSubunit 4L (ndhE)Subunit 6 (ndhG)
Length100 amino acids180 amino acids
UniProt IDB1VKI6B1VKI7
Predicted transmembrane domainsMultiple hydrophobic regionsMultiple transmembrane segments
Sequence featuresRich in hydrophobic amino acidsContains conserved functional motifs
Role in complexMembrane anchoring, potential quinone bindingExtended intermembrane region, potential regulatory role

Understanding the structural and functional relationships between these subunits provides insights into the assembly and regulation of the complete NAD(P)H dehydrogenase complex in chloroplasts .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.