Recombinant Cryptomeria japonica NAD (P)H-quinone oxidoreductase subunit 6, chloroplastic

Shipped with Ice Packs
In Stock

Description

Introduction to NAD(P)H-Quinone Oxidoreductases in Plant Systems

NAD(P)H-quinone oxidoreductases represent a crucial class of enzymes involved in electron transport chains within plant chloroplasts. These enzymes facilitate the transfer of electrons from NAD(P)H to quinones in the photosynthetic chain, coupling redox reactions to proton translocation and thereby conserving energy in a proton gradient. The NAD(P)H dehydrogenase complex in chloroplasts consists of multiple subunits that work in concert to perform this essential function. The immediate electron acceptor for this enzyme complex is believed to be plastoquinone, which plays a pivotal role in the photosynthetic electron transport chain. Cryptomeria japonica, commonly known as Japanese cedar, contains this enzyme complex in its chloroplasts, with subunit 6 being one of the crucial components for its proper functioning and efficiency .

Subunit 6 of the NAD(P)H-quinone oxidoreductase complex is encoded by the ndhG gene in the chloroplast genome of Cryptomeria japonica. This subunit, along with other components of the complex, contributes to both photosynthetic processes and potentially to a chloroplast respiratory chain. The recombinant form of this protein has been produced to facilitate research into its structure, function, and potential applications in biotechnology and plant science. Understanding the detailed molecular characteristics and functional mechanisms of this protein can provide valuable insights into photosynthetic efficiency and plant adaptation to varying environmental conditions .

Protein Classification and Nomenclature

Table 1: Classification and Nomenclature of Recombinant Cryptomeria japonica NAD(P)H-Quinone Oxidoreductase Subunit 6

ParameterDescription
Recommended NameNAD(P)H-quinone oxidoreductase subunit 6, chloroplastic
EC Number1.6.5.-
Alternative NamesNAD(P)H dehydrogenase subunit 6, NADH-plastoquinone oxidoreductase subunit 6
Gene NamendhG
Expression Region1-180
SpeciesCryptomeria japonica (Japanese cedar) (Cupressus japonica)
UniProt IDB1VKI7

The classification of this protein places it within the oxidoreductase enzyme class, specifically those that act on NADH or NADPH as electron donors and quinones as electron acceptors. The EC number 1.6.5.- indicates its enzymatic classification as an oxidoreductase acting on NAD(P)H with quinones or similar compounds as acceptors. This classification system provides a standardized way to identify and categorize the protein based on its biochemical function. The alternative names reflect different aspects of its function or historical naming conventions, with all names highlighting its role in electron transfer processes within chloroplasts .

Electron Transport Mechanism

In Cryptomeria japonica, subunit 6 of this complex plays a specific role in this electron transfer process, potentially providing binding sites for substrates or facilitating the correct positioning of other subunits within the complex. The precise molecular interactions and electron transfer pathways within this specific subunit are not fully elucidated, but based on homologous proteins, it likely contains specific amino acid residues that coordinate with cofactors or interact with other subunits to enable efficient electron transfer. The hydrophobic nature of many regions within this protein suggests that it is embedded within the membrane, positioning it optimally for its role in electron transport across the thylakoid membrane .

Role in Photosynthetic Processes

The NAD(P)H-quinone oxidoreductase complex, including subunit 6, plays a significant role in cyclic electron flow around photosystem I in plant chloroplasts. This process is distinct from linear electron flow and serves several important functions in photosynthesis. Cyclic electron flow helps balance the ATP/NADPH ratio produced during photosynthesis, which is crucial for optimal carbon fixation in the Calvin cycle. It also contributes to photoprotection by dissipating excess light energy, particularly under stress conditions such as high light intensity or drought. The complex may also participate in chlororespiration, a respiratory electron transport chain in chloroplasts that operates in the dark or under stress conditions. These functions collectively enhance the adaptability of plants to varying environmental conditions and optimize photosynthetic efficiency under different circumstances .

In Cryptomeria japonica, a coniferous species that often grows in competitive forest environments, the efficient functioning of this complex may be particularly important for survival and growth. The regulation of this complex's activity in response to environmental cues such as light intensity, temperature, and water availability likely contributes to the adaptive capacity of this species. Research suggests that the expression and activity of NAD(P)H-quinone oxidoreductase subunits, including subunit 6, may be modulated in response to various environmental stressors, reflecting their importance in plant stress responses and adaptation mechanisms .

Expression and Purification Methods

The recombinant form of Cryptomeria japonica NAD(P)H-quinone oxidoreductase subunit 6 has been successfully expressed in microbial host systems, providing a valuable tool for research purposes. The protein is typically expressed with a tag (such as His-tag) to facilitate purification through affinity chromatography techniques. The expression system is designed to produce the full-length protein (amino acids 1-180), maintaining its structural integrity and functional properties. Following expression, the protein undergoes a series of purification steps to remove host cell proteins and other contaminants, resulting in a highly purified product suitable for various research applications. The purification process may include multiple chromatographic steps, including affinity chromatography, ion exchange chromatography, and size exclusion chromatography, to achieve the desired level of purity. The final product is typically assessed for purity using techniques such as SDS-PAGE and may undergo further quality control measures to ensure its suitability for research purposes .

The expression of this membrane protein in recombinant systems presents several challenges due to its hydrophobic nature and potential toxicity to host cells. Strategies to overcome these challenges may include using specialized host strains, optimizing expression conditions, and employing fusion partners that enhance solubility or membrane integration. The successful production of this recombinant protein enables detailed studies of its structure, function, and interactions that would be difficult to conduct using native protein isolated from plant tissues. The availability of recombinant protein also facilitates the development of tools such as antibodies for detection and quantification of the native protein in plant samples .

Current Research Applications

The study of NAD(P)H-quinone oxidoreductases, including subunit 6 from Cryptomeria japonica, also contributes to comparative biochemical studies across different plant species. Such comparative analyses can reveal evolutionary adaptations in photosynthetic machinery that may correlate with different ecological niches or environmental challenges. For instance, comparing the properties and regulation of this protein complex between shade-tolerant species like Cryptomeria japonica and sun-loving species could provide insights into adaptations for efficient light utilization under different conditions. Furthermore, understanding the molecular details of this protein complex could inform strategies for engineering improved photosynthetic efficiency in crop plants, potentially enhancing yield and stress resilience in agricultural systems .

Future Research Directions and Biotechnological Applications

The recombinant Cryptomeria japonica NAD(P)H-quinone oxidoreductase subunit 6 holds significant potential for future research and biotechnological applications. One promising direction is the development of biosensors based on this protein or its derivatives for detecting quinones or monitoring electron transport activities in various biological systems. Such biosensors could have applications in environmental monitoring, food safety testing, or medical diagnostics. Another potential application lies in the field of bioenergy, where understanding and potentially modifying NAD(P)H-quinone oxidoreductases could contribute to the development of more efficient biofuel production systems or artificial photosynthetic devices. The protein could also serve as a target for developing compounds that modulate photosynthetic efficiency, potentially leading to agricultural applications for enhancing crop productivity or stress tolerance. Additionally, the structural and functional insights gained from studying this protein could inform the design of biomimetic catalysts for various oxidation-reduction reactions of industrial importance, potentially leading to more sustainable chemical production processes .

Future research directions might also include investigating the role of this protein in plant responses to environmental stresses such as drought, high light, or temperature extremes. Understanding how the activity and regulation of this protein complex change under stress conditions could provide valuable insights into plant stress adaptation mechanisms. The development of transgenic plants with modified expression or activity of this protein could serve as experimental systems for testing hypotheses about its role in photosynthesis and stress responses. Furthermore, the potential interactions of this protein with plant hormones or signaling molecules represent an interesting area for future investigation, potentially revealing new regulatory mechanisms controlling photosynthetic electron transport in response to developmental or environmental cues .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1 and 1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
ndhG; NAD(PH-quinone oxidoreductase subunit 6, chloroplastic; NAD(PH dehydrogenase subunit 6; NADH-plastoquinone oxidoreductase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-180
Protein Length
full length protein
Species
Cryptomeria japonica (Japanese cedar) (Cupressus japonica)
Target Names
ndhG
Target Protein Sequence
MNRPESIYDLLLAPLTLSLIFGGIGVVLLTNIIYSALSLGLVLICISFFYIILNADFVAV AQILIYIGAVNILILFAVMLMNNPKYPNYAPPWTVGDSISSIVCTSLFCSLITIILNISW FGISLTQKSDQMLERDLTNNIQRIGAHLSTDFFLPFELISIILLVALIGAITIARREETV
Uniprot No.

Target Background

Function
NDH (NAD(P)H-quinone oxidoreductase) shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. In this species, the immediate electron acceptor for the enzyme is believed to be plastoquinone. NDH couples the redox reaction to proton translocation, thereby conserving redox energy within a proton gradient.
Protein Families
Complex I subunit 6 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is NAD(P)H-quinone oxidoreductase subunit 6 and what is its role in Cryptomeria japonica?

NAD(P)H-quinone oxidoreductase subunit 6 (ndhG) is a chloroplastic protein that functions as part of the NAD(P)H dehydrogenase complex in Cryptomeria japonica (Japanese cedar). This enzyme is involved in chloroplast electron transport processes and plays a critical role in cyclic electron flow around photosystem I. The protein is encoded by the ndhG gene and contributes to energy metabolism in plant chloroplasts. The enzyme catalyzes the reduction of quinones using either NADH or NADPH as electron donors, which is essential for photosynthetic efficiency and stress response in conifers .

How does NAD(P)H-quinone oxidoreductase subunit 6 differ from other NAD(P)H dehydrogenase subunits in Cryptomeria japonica?

NAD(P)H-quinone oxidoreductase subunit 6 (ndhG) differs from other related subunits such as subunit 4L (ndhE) in several aspects including size, amino acid composition, and specific functional roles within the NDH complex. While subunit 6 consists of 180 amino acids, subunit 4L is smaller with only 100 amino acids . The primary sequences show distinct patterns of hydrophobic and hydrophilic residues, reflecting their different positions and functions within the multi-subunit complex. Subunit 6 likely interacts with different protein partners and may be involved in specific aspects of electron transfer or complex assembly that differ from the roles of other subunits .

What are the optimal storage conditions for maintaining activity of recombinant NAD(P)H-quinone oxidoreductase subunit 6?

For optimal storage of recombinant NAD(P)H-quinone oxidoreductase subunit 6 from Cryptomeria japonica, the following conditions are recommended:

  • Store the protein at -20°C for regular use

  • For extended storage, maintain at -20°C to -80°C

  • The protein is typically provided in a Tris-based buffer with 50% glycerol, optimized for stability

  • Avoid repeated freeze-thaw cycles as this can significantly reduce protein activity

  • For working solutions, store aliquots at 4°C for up to one week

  • When preparing aliquots, use sterile techniques to prevent contamination

These storage conditions help maintain the structural integrity and functional activity of the protein for experimental applications.

What methods are most effective for protein expression and purification of NAD(P)H-quinone oxidoreductase subunit 6?

Based on established protocols for similar recombinant proteins from Cryptomeria japonica, the most effective methods for expression and purification include:

  • Expression System Selection: E. coli-based expression systems are commonly used, with codon optimization to enhance expression levels of plant proteins .

  • Vector Design: Vectors containing appropriate promoters (e.g., T7) with His-tag or other affinity tags facilitate purification while maintaining protein function .

  • Induction Conditions: Optimization of IPTG concentration, temperature (typically lowered to 16-25°C during induction), and induction duration to maximize soluble protein yield.

  • Purification Strategy:

    • Immobilized metal affinity chromatography (IMAC) for His-tagged proteins

    • Size exclusion chromatography as a polishing step

    • Buffer optimization to maintain protein stability throughout purification

  • Quality Control: SDS-PAGE and Western blotting to verify purity, with activity assays to confirm functional integrity .

These methodologies can be adapted based on specific research requirements and the particular characteristics of the recombinant protein.

What assay methods can be used to measure the enzymatic activity of NAD(P)H-quinone oxidoreductase subunit 6?

Several assay methods can be employed to measure the enzymatic activity of NAD(P)H-quinone oxidoreductase subunit 6:

  • Spectrophotometric Assays:

    • Monitoring the oxidation of NAD(P)H at 340 nm

    • Following the reduction of various quinone substrates through absorbance changes

  • Electron Transfer Activity:

    • Measuring the reduction of artificial electron acceptors like dichlorophenolindophenol (DCPIP) or ferricyanide

    • Monitoring oxygen consumption rates in polarographic assays

  • Reconstitution Experiments:

    • Incorporation of the purified subunit into liposomes or membrane systems

    • Measuring electron transport in reconstituted systems

  • Coupled Enzyme Assays:

    • Using reporter enzymes to amplify signal detection

    • Coupling quinone reduction to subsequent enzymatic reactions

When designing these assays, it's important to consider appropriate controls, substrate concentrations, and reaction conditions (pH, temperature, ionic strength) to accurately measure the specific activity of the enzyme .

How can recombinant NAD(P)H-quinone oxidoreductase subunit 6 be used in studies of photosynthetic electron transport in conifers?

Recombinant NAD(P)H-quinone oxidoreductase subunit 6 from Cryptomeria japonica can be instrumental in advancing our understanding of photosynthetic electron transport in conifers through several experimental approaches:

These approaches contribute to our fundamental understanding of conifer photosynthesis and potential adaptation mechanisms to environmental stresses.

What role might NAD(P)H-quinone oxidoreductase play in oxidative stress response in Cryptomeria japonica?

NAD(P)H-quinone oxidoreductase likely plays a significant role in oxidative stress responses in Cryptomeria japonica through several mechanisms:

  • Quinone Detoxification: Similar to other NAD(P)H:quinone oxidoreductases, the subunit 6-containing complex may catalyze the complete two-electron reduction of potentially harmful quinones, preventing the formation of semiquinone radicals that can generate reactive oxygen species (ROS) .

  • Maintenance of Antioxidants: The enzyme system may be involved in maintaining pools of reduced antioxidants within chloroplasts, particularly under stress conditions that increase ROS production .

  • Cyclic Electron Flow Regulation: During environmental stress, the NDH complex containing subunit 6 likely participates in cyclic electron flow around photosystem I, which helps dissipate excess excitation energy and prevent ROS formation.

  • Signaling Functions: The activity of the complex may influence redox signaling pathways that trigger adaptive responses to oxidative stress.

  • Protection of Photosynthetic Apparatus: By modulating electron transport rates in response to environmental conditions, the enzyme helps protect the photosynthetic apparatus from photo-oxidative damage .

Understanding these roles has implications for improving conifer resilience to environmental stresses and climate change.

How can CRISPR/Cas9 genome editing be applied to study NAD(P)H-quinone oxidoreductase function in Cryptomeria japonica?

CRISPR/Cas9 genome editing offers powerful approaches to study NAD(P)H-quinone oxidoreductase function in Cryptomeria japonica:

  • Gene Knockout Studies: Creating targeted mutations in the ndhG gene to generate knockout lines for phenotypic analysis and functional characterization. This would reveal the physiological consequences of losing subunit 6 function.

  • Domain-Specific Mutations: Introducing precise modifications to functional domains within the gene to study structure-function relationships without completely abolishing protein expression.

  • Reporter Gene Fusions: Inserting reporter genes (such as GFP) in-frame with ndhG to track protein localization and expression patterns under various conditions.

  • Promoter Modifications: Altering the native promoter to study transcriptional regulation or creating inducible expression systems.

  • Implementation Strategy:

    • Design guide RNAs targeting specific regions of the ndhG gene

    • Construct CRISPR/Cas9 vectors adapted for conifer transformation

    • Transform embryogenic tissue via Agrobacterium-mediated transformation

    • Regenerate and screen transformed plants

    • Characterize the resulting phenotypes

The CRISPR/Cas9 approach has been successfully applied to other genes in Cryptomeria japonica, demonstrating its feasibility for studying chloroplast proteins like NAD(P)H-quinone oxidoreductase subunit 6 .

What are common challenges in expressing recombinant NAD(P)H-quinone oxidoreductase subunit 6, and how can they be addressed?

Researchers commonly encounter several challenges when expressing recombinant NAD(P)H-quinone oxidoreductase subunit 6 from Cryptomeria japonica:

  • Low Expression Levels:

    • Challenge: As a membrane protein, subunit 6 often expresses poorly in bacterial systems.

    • Solution: Optimize codon usage for the expression host, use specialized strains (C41/C43), lower induction temperature (16-20°C), and consider fusion partners that enhance solubility.

  • Protein Misfolding and Inclusion Bodies:

    • Challenge: Incorrect folding leading to insoluble aggregates.

    • Solution: Co-express with molecular chaperones, use milder detergents for extraction, or develop refolding protocols from inclusion bodies.

  • Protein Instability:

    • Challenge: Rapid degradation during expression or purification.

    • Solution: Include protease inhibitors, optimize buffer conditions (pH, salt concentration, glycerol), and perform purification steps at 4°C.

  • Low Enzymatic Activity:

    • Challenge: Purified protein shows reduced or no activity.

    • Solution: Ensure proper cofactor incorporation, verify protein structural integrity, and optimize assay conditions.

  • Verification Table for Troubleshooting Expression Issues:

IssueDiagnostic TestPotential Solutions
Low expressionSDS-PAGE, Western blotChange expression strain, optimize induction parameters
InsolubilitySolubility fractionationAdd solubilizing tags, use membrane protein-specific detergents
DegradationTime-course samplingAdd protease inhibitors, reduce expression time
MisfoldingCircular dichroismCo-express chaperones, optimize folding conditions
Low activityActivity assaysVerify cofactor presence, test different buffer compositions

These strategies can significantly improve the yield and quality of recombinant NAD(P)H-quinone oxidoreductase subunit 6 for research applications .

How can researchers distinguish between specific and non-specific activities when characterizing NAD(P)H-quinone oxidoreductase function?

Distinguishing between specific and non-specific activities is crucial when characterizing NAD(P)H-quinone oxidoreductase function. Researchers should implement the following approaches:

  • Substrate Specificity Analysis:

    • Perform kinetic analyses with various quinone substrates and electron donors

    • Compare Km and Vmax values across substrates to identify preferential activities

    • Plot substrate saturation curves to identify specific versus non-specific interactions

  • Inhibitor Studies:

    • Use known specific inhibitors of NAD(P)H-quinone oxidoreductases

    • Create dose-response curves to determine IC50 values

    • Compare inhibition patterns with those of characterized enzymes

  • Control Experiments:

    • Include heat-inactivated enzyme controls

    • Use related but functionally distinct proteins as negative controls

    • Test activity in the absence of key cofactors

  • Mutagenesis Validation:

    • Generate site-directed mutants targeting catalytic residues

    • Verify that mutations in the active site eliminate specific activity while non-specific activities remain unchanged

  • Statistical Analysis of Activity Data:

    • Use appropriate statistical methods to distinguish significant activity from background

    • Implement replicate measurements to establish confidence intervals

    • Apply correction factors for non-enzymatic reactions

These methodological approaches help researchers confidently attribute observed activities to the specific function of NAD(P)H-quinone oxidoreductase subunit 6.

What analytical techniques are most informative for studying interactions between NAD(P)H-quinone oxidoreductase subunit 6 and other components of photosynthetic complexes?

The most informative analytical techniques for studying interactions between NAD(P)H-quinone oxidoreductase subunit 6 and other components of photosynthetic complexes include:

  • Co-Immunoprecipitation (Co-IP):

    • Uses antibodies against subunit 6 to pull down interaction partners

    • Can be coupled with mass spectrometry for unbiased identification of binding partners

    • Allows detection of native complexes under physiological conditions

  • Crosslinking Mass Spectrometry (XL-MS):

    • Employs chemical crosslinkers to covalently connect interacting proteins

    • Provides spatial constraints for modeling protein complex structures

    • Can capture transient interactions that may be lost in other methods

  • Blue Native PAGE:

    • Separates intact protein complexes under non-denaturing conditions

    • Reveals the assembly state and stability of multi-protein complexes

    • Can be combined with second-dimension SDS-PAGE to identify complex components

  • Förster Resonance Energy Transfer (FRET):

    • Measures energy transfer between fluorescently labeled proteins

    • Provides information about proximity (<10 nm) between interaction partners

    • Can be used in live cells to monitor dynamic interactions

  • Surface Plasmon Resonance (SPR):

    • Quantifies binding affinities and kinetics of protein-protein interactions

    • Allows real-time monitoring of association and dissociation

    • Requires purified components but provides detailed binding parameters

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Maps protein interaction surfaces by measuring changes in hydrogen-deuterium exchange rates

    • Identifies regions protected from solvent upon complex formation

    • Provides structural insights without requiring protein crystallization

These techniques, often used in combination, provide complementary information about the structural and functional relationships between NAD(P)H-quinone oxidoreductase subunit 6 and other components of photosynthetic machinery .

What emerging technologies might advance our understanding of NAD(P)H-quinone oxidoreductase function in Cryptomeria japonica?

Several emerging technologies hold promise for advancing our understanding of NAD(P)H-quinone oxidoreductase function in Cryptomeria japonica:

  • Cryo-Electron Microscopy (Cryo-EM):

    • High-resolution structural analysis of the entire NDH complex

    • Visualization of conformational changes during catalytic cycles

    • Mapping the precise location of subunit 6 within the larger complex

  • Single-Molecule Techniques:

    • Single-molecule FRET to capture dynamic conformational changes

    • Optical tweezers to measure force generation during electron transport

    • Single-particle tracking to monitor complex assembly and mobility

  • Advanced Genome Editing:

    • Prime editing for precise nucleotide substitutions without double-strand breaks

    • Base editing for creating specific amino acid changes

    • Multiplexed CRISPR systems for simultaneous modification of multiple subunits

  • Synthetic Biology Approaches:

    • Creating minimal synthetic NDH complexes to define essential components

    • Engineering chimeric complexes with subunits from different species

    • Developing optogenetic controls for NDH complex activity

  • Multi-Omics Integration:

    • Combining proteomics, metabolomics, and transcriptomics data

    • Network analysis to place NDH function in broader cellular contexts

    • Machine learning approaches to predict functional interactions

These technologies promise to reveal new insights into the structure, function, and regulation of NAD(P)H-quinone oxidoreductase subunit 6 and its role in conifer physiology.

How might comparative studies of NAD(P)H-quinone oxidoreductase across different plant species inform our understanding of its evolution and adaptation?

Comparative studies of NAD(P)H-quinone oxidoreductase across different plant species can provide valuable insights into evolutionary processes and adaptive mechanisms:

  • Phylogenetic Analysis:

    • Reconstructing the evolutionary history of subunit 6 across plants

    • Identifying conserved domains that indicate functionally critical regions

    • Detecting signatures of selection that might reflect adaptation to different environments

  • Structure-Function Comparisons:

    • Relating sequence variations to functional differences between species

    • Identifying species-specific insertions or deletions that might confer specialized functions

    • Comparing enzyme kinetics across species with different photosynthetic adaptations

  • Expression Pattern Analysis:

    • Comparing tissue-specific expression patterns across species

    • Analyzing responses to environmental stresses in different plant lineages

    • Identifying regulatory elements that have evolved to control expression

  • Experimental Verification Through Chimeric Proteins:

    • Creating hybrid proteins with domains from different species

    • Testing the functional consequences of sequence variations

    • Identifying the molecular basis for species-specific properties

  • Ecological Correlation Studies:

    • Relating enzyme properties to habitat characteristics

    • Comparing enzymes from plants adapted to different light environments

    • Identifying variations that correlate with stress tolerance

These comparative approaches can reveal how NAD(P)H-quinone oxidoreductase has evolved and adapted to various ecological niches, providing insights into both fundamental evolutionary processes and potential applications in plant improvement .

What potential applications might arise from deeper understanding of NAD(P)H-quinone oxidoreductase function in photosynthetic efficiency and stress tolerance?

A deeper understanding of NAD(P)H-quinone oxidoreductase function in Cryptomeria japonica could lead to several innovative applications:

  • Engineered Photosynthetic Efficiency:

    • Modifying NAD(P)H-quinone oxidoreductase to optimize electron transport rates

    • Fine-tuning cyclic electron flow to improve energy conversion efficiency

    • Designing plants with enhanced carbon fixation capabilities

  • Improved Stress Tolerance:

    • Engineering variants with enhanced protective functions against oxidative damage

    • Developing crops with improved performance under drought, high light, or temperature stress

    • Creating trees with better adaptation to climate change conditions

  • Biosensor Development:

    • Using modified NAD(P)H-quinone oxidoreductase as biosensors for environmental pollutants

    • Developing screening systems for compounds that affect photosynthetic electron transport

    • Creating diagnostic tools for plant stress detection

  • Bioenergy Applications:

    • Engineering electron transport chains for improved biofuel production

    • Optimizing energy capture and conversion for biotechnological applications

    • Developing artificial photosynthetic systems incorporating modified oxidoreductases

  • Pharmaceutical Targets:

    • Identifying specific inhibitors of plant NAD(P)H-quinone oxidoreductases for herbicide development

    • Understanding structural differences between plant and human enzymes for selective targeting

    • Exploring the potential of plant-derived NAD(P)H-quinone oxidoreductases for therapeutic applications

These applications highlight the translational potential of basic research on NAD(P)H-quinone oxidoreductase, spanning agricultural improvement, environmental monitoring, and biotechnology .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.