Recombinant Cryptomeria japonica Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The recombinant protein is synthesized with tags (e.g., N-terminal His-tag) for purification. Key steps include:

StepMethod
Expression HostE. coli (common) or yeast (e.g., for Cryptomeria japonica)
PurificationSDS-PAGE, anion-exchange chromatography (e.g., DEAE columns)
Storage BufferTris-based buffer with 50% glycerol (-20°C/-80°C)
Purity>90% (SDS-PAGE validated)

For Cryptomeria japonica CP47, the full-length protein (1–508 aa) is expressed, with a calculated MW of ~47 kDa .

Research Applications and Findings

Recombinant CP47 is used to study PSII assembly and light-harvesting mechanisms. Key studies include:

Study FocusKey Finding
PSII AssemblyCP47 binds first to D1/D2 reaction center, forming intermediate complexes
Pigment BindingRecombinant CP47 binds chlorophyll a and β-carotene but lacks full PSII functionality
Evolutionary HomologyCP47 shares structural motifs with PSI core proteins (PsaA/PsaB)

Challenges and Limitations

  • Proper Folding: Recombinant CP47 may lack native pigment binding efficiency due to incomplete folding .

  • Host Compatibility: Cryptomeria japonica CP47 requires specific conditions (e.g., yeast expression) for proper processing .

Data Tables

Table 1: Recombinant CP47 Production Parameters

ParameterCryptomeria japonica Lactuca sativa
HostE. coliE. coli
TagN/AN-terminal His-tag
Expression RegionFull-length (1–508 aa)Full-length (1–508 aa)
Storage BufferTris, 50% glycerolTris/PBS, 6% trehalose

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing the order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize development according to your specification.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Cryptomeria japonica (Japanese cedar) (Cupressus japonica)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLIAVHIMHTALVSGWAGSMALYELAVFDPSDPILDPMWRQGM FVIPFMTRLGIKDSWGGWSITGETGSNPGIWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL DVFCDSRTGKPSLDLPKIFGIHLFLSGAACFGFGAFHVTGLYGPGIWVSDPYGLTGKIQP VNPAWGAEGFDPFVPGGIASHHIAAGILGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFIVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIDRRVRAGLAENLSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGAMDNGDGIAVGWLGHPIFKDKNGHELFVRRMP TFFETFPVVLVDEEGIVKADVPFRRAESKYSVEQVGVTVEFYGGELDGVSFGDPAIVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHATFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGAFQKLGDPTTKRQVV
Uniprot No.

Target Background

Function
Cryptomeria japonica Photosystem II CP47 chlorophyll apoprotein (psbB) is a key component of the photosystem II (PSII) core complex. It binds chlorophyll and plays a crucial role in catalyzing the primary light-induced photochemical reactions within PSII. PSII functions as a light-driven water:plastoquinone oxidoreductase, utilizing light energy to extract electrons from H₂O, generating O₂ and a proton gradient that subsequently drives ATP formation.
Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the psbB gene and what protein does it encode in photosynthetic organisms?

The psbB gene encodes the CP-47 protein, a core component of Photosystem II. This protein has been hypothesized to play a crucial role in binding reaction center chlorophyll in photosynthetic organisms. Research on psbB from cyanobacteria like Synechocystis has revealed significant homology with plant versions, with DNA sequence showing 68% homology to spinach psbB and amino acid sequence demonstrating 76% homology . The high conservation across diverse species highlights the protein's evolutionary importance in photosynthesis.

How is CP-47 structurally organized in the thylakoid membrane?

CP-47 displays consistent hydropathy patterns across species like Synechocystis and spinach, indicating a conserved folding pattern within the thylakoid membrane . The protein contains five pairs of histidine residues spaced by 13 or 14 amino acids located in hydrophobic regions. These histidine pairs are hypothesized to be involved in chlorophyll binding, creating specific binding pockets that position chlorophyll molecules optimally for light harvesting and energy transfer .

What approaches are most effective for isolating and studying CP-47 protein from plant sources?

For isolation of CP-47 from plant sources, researchers typically employ a multi-step purification protocol. First, thylakoid membranes are isolated through differential centrifugation followed by detergent solubilization using mild detergents like n-dodecyl-β-D-maltoside (β-DDM) or digitonin to maintain protein complex integrity. Subsequent purification may involve ion-exchange chromatography (particularly diethylaminoethyl and carboxymethyl cellulose matrices) and size exclusion chromatography such as Sephadex G-150 . For recombinant protein production, established systems using E. coli or yeast expression platforms can be employed, though membrane proteins often present challenges requiring specialized expression tags and solubilization strategies.

How can researchers effectively clone and characterize the psbB gene from new plant species such as Cryptomeria japonica?

For cloning the psbB gene from Cryptomeria japonica, researchers should:

  • Begin with total cDNA preparation from photosynthetically active tissues (needles)

  • Design degenerate primers based on conserved regions of psbB from related species

  • Amplify the target gene using PCR with high-fidelity polymerase

  • Clone and sequence the amplified product to obtain the complete gene sequence

  • Verify the sequence through bioinformatic analysis, comparing with known psbB sequences

Characterization should include analysis of:

  • Gene structure (exons, introns, regulatory elements)

  • Predicted protein features through hydropathy plots and motif analysis

  • Phylogenetic comparison with other plant species

  • Expression patterns across different tissues and environmental conditions

What are validated methods for studying protein-protein interactions involving CP-47 in Photosystem II assembly?

Studying CP-47 protein interactions requires techniques that preserve native membrane protein associations. Effective approaches include:

  • Affinity-tagging strategies: Histidine-tagged derivatives of CP-47 or its interaction partners can be used with nickel-affinity chromatography to isolate intact complexes and identify binding partners

  • Cross-linking mass spectrometry (XL-MS): This method can identify interaction interfaces in membrane protein complexes

  • Blue native polyacrylamide gel electrophoresis (BN-PAGE): Useful for separating intact protein complexes and assessing complex assembly

  • Förster resonance energy transfer (FRET) analysis: For studying dynamic interactions in vivo

  • Co-immunoprecipitation with antibodies specific to CP-47 or potential interaction partners

Research has demonstrated the association of proteins like Psb28 with CP-47, indicating structural relationships that can be further explored with these methods .

How does the genetic variation in psbB across Cryptomeria japonica populations impact photosynthetic efficiency?

  • Sequence the psbB gene across multiple Cryptomeria japonica populations

  • Correlate sequence variations with environmental parameters

  • Measure photosynthetic parameters in plants from different populations

  • Perform reciprocal transplant experiments to assess fitness impacts

  • Utilize chlorophyll fluorescence analysis to measure PSII efficiency across genotypes

This approach would help determine if natural selection has acted on psbB to optimize photosynthesis under different environmental conditions across the species' range.

What is the role of CP-47 in the assembly pathway of Photosystem II in Cryptomeria japonica compared to model plant systems?

Research on Photosystem II assembly in cyanobacteria has revealed that CP-47 is incorporated at a specific stage, forming the RC47 complex (PSII complex lacking CP43) . In investigating assembly pathways in Cryptomeria japonica compared to model plants, researchers should:

  • Establish a time-course analysis of PSII assembly using pulse-chase labeling

  • Isolate assembly intermediates through sucrose gradient centrifugation

  • Identify protein components at each stage using mass spectrometry

  • Create mutants with tagged versions of assembly factors to track interactions

  • Compare assembly kinetics between Cryptomeria japonica and model systems

This research would benefit from examining the role of auxiliary proteins like Psb28, which has been shown to interact with CP-47 and play an important role in chlorophyll synthesis and/or CP47 assembly in cyanobacteria .

How do environmental stress conditions affect post-translational modifications of CP-47 in Cryptomeria japonica?

CP-47 may undergo various post-translational modifications (PTMs) in response to environmental stresses. To investigate this:

  • Expose Cryptomeria japonica to various stress conditions (drought, temperature extremes, high light)

  • Isolate thylakoid membranes and purify CP-47 protein

  • Analyze PTMs using mass spectrometry techniques (particularly phosphorylation, acetylation, and oxidative modifications)

  • Correlate modifications with changes in photosynthetic efficiency

  • Perform site-directed mutagenesis of modification sites to assess functional significance

Since Cryptomeria japonica has a broad natural distribution and can survive in diverse environments , comparing PTM patterns between populations adapted to different conditions could provide insights into stress adaptation mechanisms.

How does the CP-47 protein sequence in Cryptomeria japonica compare with other gymnosperms and photosynthetic organisms?

Comparison of CP-47 sequences across photosynthetic organisms reveals evolutionary conservation patterns. When studying CP-47 in Cryptomeria japonica:

  • Perform multiple sequence alignment of CP-47 from diverse photosynthetic organisms

  • Identify conserved domains and critical residues (particularly the five pairs of histidine residues implicated in chlorophyll binding)

  • Analyze selection pressures on different protein domains using dN/dS ratios

  • Construct phylogenetic trees to understand evolutionary relationships

  • Compare protein models to assess structural conservation

Given that CP-47 from cyanobacteria and spinach show 76% amino acid sequence homology , examining the degree of conservation in Cryptomeria japonica would provide insights into gymnosperm-specific adaptations in this crucial photosynthetic protein.

What experimental approaches would best identify specific chlorophyll-binding sites in Cryptomeria japonica CP-47?

Identifying chlorophyll-binding sites requires specialized approaches:

  • Site-directed mutagenesis of predicted binding sites (particularly the histidine pairs spaced by 13-14 amino acids)

  • Spectroscopic analysis of wild-type and mutant proteins

  • X-ray crystallography or cryo-electron microscopy of the protein with bound chlorophyll

  • Resonance Raman spectroscopy to analyze chlorophyll-protein interactions

  • Computational modeling and docking simulations

Research in other systems suggests that CP-47 contains specific histidine residues in hydrophobic regions that coordinate chlorophyll molecules . Verifying these binding sites in Cryptomeria japonica would provide valuable comparative data across evolutionary lineages.

What are the key considerations when designing knockout or knockdown experiments for psbB in Cryptomeria japonica?

Designing effective psbB modification experiments requires careful consideration of:

  • Transformation method: Gymnosperm transformation is challenging; Agrobacterium-mediated approaches or biolistic methods may be required

  • Selection strategy: Choose appropriate selectable markers and optimization of selection conditions

  • Tissue culture conditions: Establish optimal regeneration protocols for transformed tissue

  • Verification methods: Develop PCR-based genotyping and expression analysis protocols

  • Phenotypic analysis: Plan comprehensive photosynthetic phenotyping including chlorophyll fluorescence measurements

Previous research in cyanobacteria demonstrated that complete interruption of the psbB gene results in loss of Photosystem II activity , so researchers should consider using inducible or tissue-specific promoters for knockdown approaches rather than complete knockouts, which might be lethal.

How can researchers address challenges in producing functional recombinant CP-47 protein for biochemical studies?

Production of functional membrane proteins like CP-47 presents significant challenges:

  • Expression system selection: Consider chloroplast transformation systems or cell-free expression systems for better membrane protein folding

  • Fusion tags: Incorporate solubility-enhancing tags (such as MBP) that can be cleaved post-purification

  • Detergent optimization: Test various detergents for solubilization efficiency while maintaining protein function

  • Lipid nanodisc incorporation: Transfer purified protein into nanodiscs for stability in a membrane-like environment

  • Functional verification: Develop assays to verify chlorophyll binding and structural integrity

Researchers should be aware that CP-47 is a complex membrane protein with multiple transmembrane domains and specific chlorophyll-binding sites, requiring careful optimization of expression and purification conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.