Recombinant Cucumis sativus Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Note: The tag type is determined during production. If a specific tag is required, please inform us, and we will prioritize its development.
Synonyms
petA; CsCp053; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-320
Protein Length
Full Length of Mature Protein
Species
Cucumis sativus (Cucumber)
Target Names
petA
Target Protein Sequence
YPIFAQQGYENPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVVRIPYDMQLKQV LANGKKGGLNVGAVLILPEGFELAPPDRISPEIKEKMGNLSFQSYRPTKKNILVIGPVPG QKYSEITFPILSPDPATKKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNNVYNATAAGIVS KIIRKEKGGYEITIVDAANGRQVVDIIPPGPELLVSEGESIKLDQPLTSNPNVGGFGQGD AEIVLQDPLRVQGLLFFFASVILAQIFLVLKKKQFEKVQLSEMNF
Uniprot No.

Target Background

Function

Recombinant Cucumis sativus Apocytochrome f (petA) is a component of the cytochrome b6-f complex. This complex mediates electron transfer between Photosystem II (PSII) and Photosystem I (PSI), facilitates cyclic electron flow around PSI, and participates in state transitions.

Database Links

KEGG: csv:3429265

Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is Apocytochrome f (petA) and what is its functional significance?

Apocytochrome f, encoded by the petA gene in Cucumis sativus (cucumber), is a critical component of the cytochrome b6f complex involved in the photosynthetic electron transport chain. This protein plays an essential role in transferring electrons between photosystem II and photosystem I, making it crucial for energy conversion during photosynthesis. The mature protein spans amino acids 36-320 and functions after proper folding and incorporation into thylakoid membranes . Unlike its holoCytochrome f counterpart, the apocytochrome form lacks the covalently attached heme group, representing an important intermediate in cytochrome assembly.

How does recombinant expression affect protein characteristics?

When expressed recombinantly in E. coli systems, Cucumis sativus Apocytochrome f (petA) is typically produced with an N-terminal His-tag to facilitate purification. This expression system yields high purity (>90% as determined by SDS-PAGE) but presents the protein in a form that differs from its native state in several ways:

  • The recombinant protein lacks native post-translational modifications that may occur in planta

  • The addition of the His-tag slightly alters the molecular weight and potentially surface charge distribution

  • Without proper membrane incorporation, the protein may adopt different conformational states than in its native environment

These differences must be considered when designing experiments to study protein function or interaction networks.

How can researchers differentiate between apocytochrome f and holocytochrome f in experimental systems?

Distinguishing between apocytochrome f and its heme-containing holocytochrome form requires specific analytical approaches:

TechniqueApplicationDistinguishing Features
Absorption SpectroscopyDetection of hemeHolocytochrome shows characteristic peaks at ~550-560 nm
SDS-PAGE with heme stainingVisual identificationHolocytochrome shows peroxidase activity with appropriate stains
Mass SpectrometryPrecise mass determinationMass difference corresponding to heme moiety (~616 Da)
Circular DichroismSecondary structure analysisDifferent spectral characteristics due to heme influence

For recombinant studies focusing specifically on apocytochrome f properties, researchers should verify the absence of heme using these techniques before proceeding with functional characterization.

What are the emerging approaches for studying Apocytochrome f interactions with other photosynthetic components?

Recent advances in structural biology and protein interaction studies have opened new avenues for investigating Apocytochrome f:

  • Cryo-electron microscopy (Cryo-EM) provides near-atomic resolution of cytochrome complexes without crystallization

  • Surface plasmon resonance (SPR) enables real-time monitoring of binding kinetics between Apocytochrome f and potential interaction partners

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) reveals conformational dynamics and binding interfaces

  • Microscale thermophoresis (MST) allows investigation of interactions in near-native conditions with minimal protein consumption

When designing such experiments with recombinant Cucumis sativus Apocytochrome f, researchers should consider that the His-tag may influence interaction surfaces and potentially include tag-removal steps using appropriate proteases.

How does Cucumis sativus Apocytochrome f compare with homologous proteins in model plant species?

Comparative analysis of Apocytochrome f across plant species reveals important evolutionary insights:

While direct comparative data specific to Cucumis sativus is limited in the available search results, cytochrome P450 family proteins in cucumber have been extensively studied. For example, CsCYP86B1 has been identified as a candidate gene controlling fruit skin gloss in cucumber , while CsCYP85A1 is implicated in brassinosteroid biosynthesis and plant height regulation . These studies demonstrate the importance of cytochrome proteins in cucumber development and physiology, providing context for understanding potential broader functions of cytochrome f beyond photosynthesis.

What is the recommended protocol for reconstituting lyophilized Recombinant Cucumis sativus Apocytochrome f?

For optimal reconstitution of lyophilized Recombinant Cucumis sativus Apocytochrome f:

  • Briefly centrifuge the vial before opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • For long-term storage, add glycerol to a final concentration of 5-50% (recommended: 50%)

  • Aliquot the reconstituted protein to avoid repeated freeze-thaw cycles

  • Store aliquots at -20°C/-80°C for long-term storage or at 4°C for up to one week

This reconstitution approach maintains protein stability while minimizing aggregation that can occur during the rehydration process.

What experimental conditions optimize Apocytochrome f stability and functionality?

Optimal conditions for working with Recombinant Cucumis sativus Apocytochrome f include:

ParameterOptimal ConditionRationale
Buffer systemTris/PBS-based buffer, pH 8.0Maintains protein solubility and mimics physiological conditions
Storage temperature-20°C/-80°C (long-term), 4°C (short-term)Prevents degradation while maintaining structure
Additives6% TrehaloseStabilizes protein during freeze-thaw and prevents aggregation
Freeze-thaw cyclesMinimize (<3 recommended)Prevents denaturation and activity loss

For functional studies, consider incorporating the protein into liposomes or nanodiscs to better mimic the native membrane environment and potentially enhance activity .

What quality control measures should be implemented when working with recombinant Apocytochrome f?

Researchers should implement the following quality control procedures:

  • Purity assessment: Confirm >90% purity via SDS-PAGE before experimental use

  • Western blot validation: Use anti-His antibodies to verify tag presence and protein identity

  • Mass spectrometry: Confirm exact molecular weight and sequence coverage

  • Functional assays: Where applicable, verify electron transfer capability using reconstituted systems

  • Thermal stability assessment: Conduct differential scanning fluorimetry to evaluate batch-to-batch consistency

These measures ensure experimental reproducibility and minimize artifacts caused by protein heterogeneity or degradation.

How can researchers design studies to investigate the role of Apocytochrome f in photosynthetic efficiency?

When investigating Apocytochrome f's role in photosynthetic efficiency, consider these experimental approaches:

  • Reconstitution studies: Incorporate purified recombinant Apocytochrome f into liposomes with other components of the electron transport chain to measure electron transfer rates

  • Mutational analysis: Introduce site-specific mutations to identify critical residues for function

  • Complementation experiments: Express recombinant Cucumis sativus Apocytochrome f in model organisms with cytochrome f deletions to assess functional conservation

  • Biophysical characterization: Use spectroscopic techniques to monitor redox potential and electron transfer kinetics

When working with the recombinant His-tagged version, researchers should be aware that the tag might affect protein dynamics or interactions and consider using tag-cleaved preparations for critical experiments.

What common challenges arise in Apocytochrome f research and how can they be addressed?

ChallengeProbable CauseSolution
Low protein solubilityHydrophobic regions designed for membrane insertionAdd mild detergents or use specialized solubilization buffers
Aggregation after reconstitutionImproper folding or concentration effectsReconstitute at lower concentrations; add stabilizing agents
Limited activity in functional assaysAbsence of native cofactors or partnersConsider co-expression with interacting proteins
Batch-to-batch variabilityExpression conditions in E. coliStandardize growth and induction protocols; implement rigorous QC
Non-specific binding in interaction studiesHis-tag interferenceInclude imidazole controls; consider tag removal

For experiments examining structure-function relationships, genetic approaches using the cucumber cytochrome P450 mutants described in studies of CsCYP85A1 provide useful methodological parallels, as they demonstrate successful approaches to studying cytochrome family proteins in Cucumis sativus .

How are genomics and proteomics approaches enhancing our understanding of Apocytochrome f biology?

Modern omics approaches offer powerful tools for contextualizing Apocytochrome f function:

  • Comparative genomics: Analysis across Cucurbitaceae family members can reveal evolutionary conservation patterns of the petA gene

  • Transcriptomics: RNA-Seq data can identify co-expression networks associated with Apocytochrome f production under various environmental conditions

  • Proteomics: Interaction proteomics can map the protein-protein interaction network of Apocytochrome f in photosynthetic complexes

  • Metabolomics: Changes in metabolite profiles following perturbation of Apocytochrome f function can reveal downstream metabolic impacts

These approaches are particularly valuable given the emerging understanding of regulatory networks involving cytochrome family proteins in cucumber, as demonstrated by the fine mapping of QTLs associated with other cucumber cytochromes .

What role does Apocytochrome f play in stress response mechanisms in Cucumis sativus?

While the primary function of Apocytochrome f relates to photosynthetic electron transport, its potential role in stress responses warrants investigation:

  • Oxidative stress: Changes in redox balance may influence Apocytochrome f function during stress conditions

  • Light stress: High light conditions may alter expression or post-translational modifications of Apocytochrome f

  • Temperature stress: Both heat and cold stress may impact protein folding and assembly of cytochrome complexes

  • Drought response: Water limitation could influence thylakoid membrane composition and consequently Apocytochrome f function

Research on other cucumber cytochromes provides methodological frameworks for such studies, as demonstrated by the characterization of CsCYP85A1 in growth regulation under various environmental conditions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.