Recombinant Cucumis sativus ATP synthase subunit a, chloroplastic (atpI)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please clearly indicate your preferred format when placing your order, and we will fulfill your requirement.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein using deionized sterile water to achieve a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotation for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference for your needs.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the intrinsic stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is essential to minimize freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be decided during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing it according to your specifications.
Synonyms
atpI; CsCp014; ATP synthase subunit a, chloroplastic; ATP synthase F0 sector subunit a; F-ATPase subunit IV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Cucumis sativus (Cucumber)
Target Names
atpI
Target Protein Sequence
MNILLCSINTQKGLYDISGVEVGQHLYWQIGGFQVHAQVLITSWVVIAILLGSAIIAVRN PQTIPTDGQNFFEYVLEFIRDVSKTQIGEEYGPWVPFIGTMFLFIFVSNWSGALLPWKII QLPHGELAAPTNDINTTVALALLTSVAYFYAGLSKKGLSYFGKYIQPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPLVVPIPVMFLGLFTSGIQALIFATLAAAYIG ESMEGHH
Uniprot No.

Target Background

Function
This protein is a key component of the proton channel and plays a direct role in the translocation of protons across the membrane.
Database Links

KEGG: csv:3429379

Protein Families
ATPase A chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is ATP synthase subunit a, chloroplastic (atpI) in Cucumis sativus?

ATP synthase subunit a, chloroplastic (atpI) is an essential component of the FoF1-ATP synthase complex located in the chloroplast of Cucumber (Cucumis sativus). This protein is encoded by the atpI gene and plays a crucial role in the ATP synthesis reaction, which converts ADP and inorganic phosphate (Pi) to ATP during photosynthesis. The protein consists of 247 amino acids and functions as part of the membrane-embedded Fo sector of the ATP synthase complex, facilitating proton transport across the thylakoid membrane .

How does atpI function in the context of plant energy metabolism?

The atpI subunit is essential for maintaining the structural integrity and functional capacity of the ATP synthase complex in chloroplasts. It forms part of the proton channel in the Fo portion of the ATP synthase that allows H+ ions to flow down their concentration gradient. This proton motive force drives the rotation of the central stalk, which in turn drives conformational changes in the F1 portion that catalyze ATP synthesis.

How does recombinant Cucumis sativus atpI interact with inhibitory factors in experimental settings?

When working with recombinant Cucumis sativus atpI in experimental settings, researchers must consider potential interactions with inhibitory factors similar to those affecting other ATP synthases. Studies on similar systems have shown that the ATP synthase inhibitory factor 1 (IF1) can bind to the ATP synthase complex under certain conditions, particularly during ATP hydrolysis.

The inhibitory mechanism typically involves binding of IF1 to the catalytic interface between alpha and beta subunits, blocking rotary catalysis. Experimental evidence from related ATP synthases demonstrates that this inhibition can be relieved by clockwise rotation of the complex in the presence of ADP and Pi, which mimics conditions of ATP synthesis. This directional manipulation in the presence of substrates has been shown to achieve approximately 60% reactivation probability, compared to only 10% in substrate-free conditions .

For researchers working with recombinant Cucumis sativus atpI, it is important to consider these inhibitory interactions when designing in vitro assays, as they may significantly impact experimental outcomes and interpretation of results.

How can contradictory findings regarding atpI function be reconciled across different experimental systems?

Researchers working with atpI may encounter seemingly contradictory results across different experimental systems due to several factors that should be systematically addressed:

  • Sub-cellular localization differences: While atpI is primarily chloroplastic, its interactions may vary depending on isolation methods and experimental conditions. Contamination with mitochondrial ATP synthase components can lead to confounding results.

  • Post-translational modifications: The functional state of atpI can be significantly influenced by phosphorylation and other modifications. Studies with purified recombinant protein may miss these regulatory aspects present in vivo .

  • Experimental buffer compositions: The activity of ATP synthase is highly sensitive to pH, ion concentrations, and the presence of specific metabolites. Research has shown that the reactivation of inhibited ATP synthase varies dramatically with buffer composition - for instance, inorganic phosphate (Pi) alone achieved 28% reactivation while ADP alone achieved only 4% .

To reconcile contradictory findings, researchers should:

  • Document complete experimental conditions, including buffer compositions

  • Verify the integrity and modification state of the recombinant protein

  • Consider physiological context when interpreting in vitro results

  • Use multiple complementary techniques to validate findings

What are the optimal conditions for expressing and purifying recombinant Cucumis sativus atpI?

For optimal expression and purification of recombinant Cucumis sativus ATP synthase subunit a, chloroplastic (atpI), the following methodological approach is recommended:

Expression System:

  • E. coli is the preferred heterologous expression system for this protein, as demonstrated in successful recombinant production .

  • Expression constructs should include an N-terminal His-tag to facilitate purification and downstream applications.

  • The full-length protein (1-247 amino acids) should be expressed to maintain functional integrity.

Purification Protocol:

  • After cell lysis, initial purification using affinity chromatography with Ni-NTA resin is recommended to capture the His-tagged protein.

  • Further purification may employ ion-exchange chromatography followed by size-exclusion chromatography to achieve >90% purity as determined by SDS-PAGE.

  • Buffer optimization is critical - Tris/PBS-based buffers at pH 8.0 containing 6% trehalose have been shown to maintain protein stability .

Storage Considerations:

  • The purified protein should be lyophilized for long-term storage.

  • Upon reconstitution, a protein concentration of 0.1-1.0 mg/mL in deionized sterile water is recommended.

  • Addition of 5-50% glycerol (final concentration) followed by aliquoting and storage at -20°C/-80°C prevents degradation during freeze-thaw cycles .

What experimental approaches can be used to study the role of atpI in photosynthetic efficiency?

To investigate the role of Cucumis sativus atpI in photosynthetic efficiency, researchers can employ several complementary experimental approaches:

Proteomic Analysis:

  • Use isobaric tags for relative and absolute quantification (iTRAQ) to measure changes in atpI expression under different physiological conditions. This technique provides more accurate quantification than two-dimensional electrophoresis .

  • Sample collection should align with key developmental phases (e.g., 0-12h, 12-24h, 24-48h) when studying dynamic processes.

Functional Assays:

  • Measure proton transport activity as a direct indicator of ATP synthase function.

  • Compare ATP synthesis rates in isolated chloroplasts with varying levels of atpI expression.

  • Evaluate the correlation between atpI expression and photosynthetic parameters such as carbon assimilation capacity and electron transport rate.

Genetic Manipulation:

  • Develop transgenic lines with altered atpI expression to assess its impact on photosynthetic efficiency.

  • Complementation studies using recombinant atpI can help confirm functional aspects in vivo.

  • Consider heterologous expression in model systems for comparative analysis, as demonstrated with tomato AtpA in tobacco, which showed enhanced resistance properties .

Environmental Response Studies:

  • Monitor atpI expression and ATP synthase activity under various stress conditions to understand its role in stress adaptation.

  • Design split-plot experiments with controlled variables to isolate specific effects on photosynthetic efficiency.

How should researchers design experiments to investigate atpI involvement in plant defense mechanisms?

When investigating the potential role of Cucumis sativus atpI in plant defense mechanisms, researchers should consider the following experimental design principles:

Pathogen Challenge Experiments:

  • Select appropriate pathogen systems based on known plant-pathogen interactions (e.g., fungi like Botrytis cinerea).

  • Design time-course experiments with appropriate controls to capture the dynamic expression of atpI during pathogen infection.

  • Include both resistant and susceptible plant varieties to identify differential responses.

Gene Expression Analysis:

  • Quantify atpI transcript levels using qRT-PCR at defined time points following pathogen challenge.

  • Include analysis of known defense-related genes for comparison and context.

  • Consider RNA-seq approaches for a broader transcriptional landscape.

Transgenic Approaches:

  • Develop overexpression lines of atpI in model plants (similar to tomato AtpA overexpression in tobacco) to assess enhanced resistance phenotypes.

  • Use CRISPR/Cas9 for targeted mutagenesis to evaluate loss-of-function effects.

  • Measure disease incidence, hypersensitive response reactions, and reactive oxygen species balance in transgenic lines compared to controls .

Biochemical Assays:

  • Assess changes in ATP production and energy status during pathogen challenges.

  • Investigate potential post-translational modifications of atpI in response to pathogens.

  • Examine correlations between ATP synthase activity and known defense response pathways.

Data Analysis Framework:

ParameterControlPathogen-ChallengedStatistical Method
atpI expression levelBaseline measurementTime-course samplingANOVA with Tukey's post-hoc test
ATP synthesis rateMeasured before infectionMeasured at infection timepointsPaired t-test
Disease incidenceBaseline susceptibilityModified susceptibility in transgenic linesChi-square test
ROS accumulationBasal ROS levelsPathogen-induced ROS productionTwo-way ANOVA

What are the emerging research areas for Cucumis sativus atpI beyond its canonical function?

Emerging research suggests that ATP synthase components like atpI may have functions beyond their canonical roles in ATP production, opening several promising research directions:

  • Signaling roles: Investigation into whether atpI or its degradation products function as signaling molecules during stress responses or developmental transitions.

  • Protein-protein interaction networks: Comprehensive interactome studies to identify novel binding partners of atpI that might reveal unexpected cellular functions.

  • Evolutionary adaptations: Comparative genomic and functional analyses of atpI across plant species adapted to different environmental niches to identify specialized roles.

  • Biotechnological applications: Exploring the potential of atpI modifications to enhance crop resilience, similar to how tomato AtpA increases resistance to gray mold when expressed in tobacco .

  • Structural biology approaches: Application of cryo-electron microscopy to resolve the full structure of plant ATP synthase with a focus on the specific configuration and functional implications of the atpI subunit.

Researchers pursuing these directions should consider integrating multi-omics approaches to capture the full complexity of atpI function within plant cellular systems.

How might synthetic biology approaches be applied to enhance or modify atpI function?

Synthetic biology offers innovative approaches to enhance or modify Cucumis sativus atpI function for both research and potential applications:

  • Rational protein engineering: Targeted modifications to specific amino acid residues in atpI could enhance ATP synthesis efficiency or alter its sensitivity to inhibitory factors. This approach would build upon understanding of the forcible ejection mechanism of inhibitory factors and substrate-dependent reactivation .

  • Domain swapping experiments: Creating chimeric proteins by combining domains from atpI proteins of different species could reveal which regions confer specific functional properties, particularly stress tolerance or pathogen resistance capabilities.

  • Optogenetic control: Development of light-responsive versions of atpI could allow temporal and spatial control of ATP synthase activity, enabling precise studies of energy metabolism in specific plant tissues.

  • Biosensor development: Engineering atpI variants that change conformation or activity in response to specific metabolites or stress conditions could create novel in vivo sensors for studying plant physiology.

  • Minimal ATP synthase design: Simplifying the ATP synthase complex while maintaining function could provide insights into the essential components required for proton transport and ATP synthesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.