Recombinant Cucumis sativus Chlorophyll a-b binding protein of LHCII type 1

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Chlorophyll a-b binding protein of LHCII type 1; Chlorophyll a-b binding protein of LHCII type I; CAB; LHCP; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-206
Protein Length
full length protein
Species
Cucumis sativus (Cucumber)
Target Protein Sequence
PFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSTWAMLGALGCVFPELLS RNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGG PLGEVTDPIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPL ENLADHLADPVNNNAWAYATNFVPGK
Uniprot No.

Target Background

Function
The light-harvesting complex (LHC) functions as a light receptor, capturing and transferring excitation energy to associated photosystems.
Protein Families
Light-harvesting chlorophyll a/b-binding (LHC) protein family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the Chlorophyll a-b Binding Protein of LHCII Type 1 in Cucumis sativus and how does it function in photosynthesis?

The Chlorophyll a-b binding protein of LHCII type 1 in Cucumis sativus is a crucial component of the light-harvesting complex associated with Photosystem II. Functionally analogous to proteins like the soybean CAB3, it serves as a light receptor that captures and delivers excitation energy to photosystems with which it is closely associated . This protein belongs to the family of light-harvesting chlorophyll-binding proteins that are fundamental to the photosynthetic apparatus in plants, including cucumber.

In photosynthesis, this protein performs several essential functions:

  • Captures light energy through bound chlorophyll a and b molecules

  • Transfers captured excitation energy to reaction centers

  • Contributes to the structural organization of the thylakoid membrane

  • Participates in regulatory mechanisms such as non-photochemical quenching

The protein's functionality is highly dependent on its ability to bind specific pigments, including chlorophyll a, chlorophyll b, and various carotenoids, with lutein playing a particularly important structural role as observed in related LHC proteins .

How is the LHCII Type 1 gene organized within the Cucumis sativus genome?

The LHCII Type 1 gene in Cucumis sativus is part of the complex organization of the cucumber genome. Based on genomic studies of cucumber, including the B10v3 genome sequence, protein-coding genes like LHCII Type 1 are distributed across the chromosomal structure. In the B10v3 genome assembly, which has a total size of 342,288,160 bp organized in 8035 contigs, more than 98% of all protein-coding genes have been successfully assigned to chromosomes using comparative genomics approaches .

The assignment of genes to specific chromosomal locations has been achieved through various methods:

  • Use of markers to target contigs to individual chromosomes

  • FISH-BAC analysis using clones from cucumber BAC libraries

  • DArT-seq analysis for contig assignment to chromosomes

  • Comparative analysis with other cucumber genomes such as 9930 (Chinese line) and Gy14 (North American line)

Through these approaches, researchers have mapped most functional proteins, including photosynthetic components like LHCII, to their respective genomic locations. The gene structure would typically include regulatory regions, exons encoding the mature protein, and introns, with specific sequence elements that respond to light and developmental cues.

What experimental evidence supports the classification of this protein as an LHCII Type 1 protein rather than other LHC family members?

Classification of Cucumis sativus Chlorophyll a-b binding protein as an LHCII Type 1 is based on several experimental approaches that distinguish it from other LHC family members such as LHCII Type II (Lhcb2) or minor antenna complexes like CP29 (Lhcb4).

Comparative analysis methods include:

  • Sequence homology analysis: Comparison with well-characterized LHCII Type 1 proteins from model plants such as Arabidopsis thaliana reveals conserved domains and motifs specific to Type 1.

  • Immunological detection: Specific antibodies can distinguish between different LHCII types. For instance, antibodies against Lhcb2 (LHCII Type II) recognize a highly conserved sequence specific to that subfamily across photosynthetic eukaryotes .

  • Spectroscopic properties: Each LHC type exhibits characteristic absorption and fluorescence spectra based on their pigment composition and organization. LHCII Type 1 shows distinct spectral properties compared to minor antenna complexes like CP29 .

  • Pigment binding specificity: LHCII Type 1 demonstrates specific pigment-binding properties that differ from other LHC proteins. While related proteins like CP29 can accommodate different chromophores depending on the reconstitution mixture, LHCII shows more selective binding characteristics .

  • Functional assays: Expression patterns in response to light and developmental cues, as observed through methods such as western blotting, can distinguish between different LHC types .

What are the optimal expression systems for producing recombinant Cucumis sativus LHCII Type 1 protein?

The optimal expression system for producing recombinant Cucumis sativus LHCII Type 1 protein is bacterial expression in Escherichia coli, followed by in vitro reconstitution with pigments. This approach has been successfully employed for related LHC proteins and provides several advantages for research applications.

Expression in E. coli system:

  • The protein is typically expressed as inclusion bodies, which allows for high yield production

  • Expression can be driven by strong promoters like T7

  • The system facilitates isotopic labeling for NMR studies

  • Allows for site-directed mutagenesis studies to investigate structure-function relationships

Based on successful protocols for related proteins, the expression procedure involves:

  • Cloning the mature protein-coding sequence (without transit peptide) into an appropriate expression vector

  • Transformation into a suitable E. coli strain (e.g., BL21)

  • Induction of expression using IPTG

  • Harvesting of inclusion bodies containing the recombinant protein

  • Solubilization of inclusion bodies using detergents

  • In vitro reconstitution with purified pigments

This approach has been validated for the minor light-harvesting protein CP29, which showed biochemical and spectral properties identical to the native protein purified from plant tissue after reconstitution .

What methodological approaches enable successful in vitro reconstitution of recombinant LHCII Type 1 with pigments?

Successful in vitro reconstitution of recombinant LHCII Type 1 with pigments requires a carefully controlled methodology that ensures proper protein folding and pigment incorporation. Based on established protocols for related LHC proteins, the following methodological approach is recommended:

Step-by-step reconstitution protocol:

  • Preparation of pigment mixture:

    • Extract and purify chlorophyll a, chlorophyll b, and carotenoids (especially lutein) from plant material

    • Quantify pigments spectrophotometrically

    • Prepare defined mixture with appropriate Chl a/b ratio and carotenoid content

  • Protein preparation:

    • Solubilize purified recombinant protein from inclusion bodies using mild detergents

    • Remove denaturants through dialysis or buffer exchange

  • Reconstitution procedure:

    • Mix solubilized protein with pigment mixture in the presence of detergents (e.g., octyl glucoside)

    • Incubate to allow protein folding and pigment binding

    • Remove unbound pigments through sucrose gradient centrifugation or gel filtration

  • Verification of successful reconstitution:

    • Analyze pigment content by HPLC

    • Verify protein folding by circular dichroism spectroscopy

    • Assess functionality through fluorescence measurements

The carotenoid lutein plays a crucial structural role, as evidenced in studies with related proteins where lutein was found to be the only carotenoid necessary for successful reconstitution . While LHCII shows selectivity for chromophore binding, the protein scaffold can accommodate different pigment compositions depending on the reconstitution mixture, allowing for generation of variants with altered spectral properties .

How can researchers validate the structural integrity and functionality of purified recombinant LHCII Type 1?

Validating the structural integrity and functionality of purified recombinant LHCII Type 1 requires a multi-faceted approach combining biochemical, biophysical, and functional assays:

Structural integrity validation:

  • SDS-PAGE and Western blotting:

    • Confirm correct molecular weight

    • Verify immunoreactivity with specific antibodies that recognize conserved epitopes in LHCII proteins

  • Circular dichroism (CD) spectroscopy:

    • Assess secondary structure elements (α-helices and loops)

    • Compare spectra with native protein isolated from cucumber thylakoids

  • Pigment analysis by HPLC:

    • Determine chlorophyll a/b ratio

    • Confirm presence and stoichiometry of carotenoids

    • Compare pigment composition with native protein

Functional validation:

  • Absorption spectroscopy:

    • Measure absorption spectra from 350-750 nm

    • Verify characteristic peaks for chlorophyll a, chlorophyll b, and carotenoids

  • Fluorescence spectroscopy:

    • Measure excitation and emission spectra

    • Assess energy transfer efficiency between chlorophyll b and chlorophyll a

    • Determine fluorescence quantum yield

  • Thermal stability assays:

    • Monitor protein unfolding using differential scanning calorimetry

    • Compare thermal stability with native protein

  • Reconstitution into liposomes:

    • Assess membrane integration capability

    • Measure energy transfer to reaction center complexes when co-reconstituted

The recombinant protein should show biochemical and spectral properties identical to the native protein purified from cucumber thylakoids, similar to what has been observed with recombinant CP29 .

What advanced structural analysis techniques are most informative for studying recombinant Cucumis sativus LHCII Type 1?

Advanced structural analysis of recombinant Cucumis sativus LHCII Type 1 requires a combination of high-resolution techniques that can reveal the protein's organization, pigment binding sites, and structural dynamics:

High-resolution structural techniques:

These techniques can be complemented by computational approaches such as molecular dynamics simulations to gain insights into dynamic aspects of protein function that may not be captured by static structural methods.

How do specific amino acid residues contribute to pigment binding and energy transfer in LHCII Type 1?

Specific amino acid residues in LHCII Type 1 play critical roles in pigment binding and energy transfer, creating the precise molecular environment required for efficient light harvesting. Based on structural and functional studies of related LHC proteins, several key amino acid contributions can be identified:

Chlorophyll binding sites:

  • Histidine and glutamate residues provide coordination to the central Mg²⁺ ion of chlorophyll molecules

  • Hydrophobic residues (e.g., phenylalanine, leucine) create binding pockets that stabilize the chlorophyll phytol tails

  • Hydrogen-bonding residues influence the electronic properties of chlorophylls, fine-tuning their absorption characteristics

Carotenoid binding:

  • Tyrosine residues form π-π interactions with carotenoid molecules

  • Hydrophobic amino acids create binding channels for the polyene chain of carotenoids

  • Lutein molecules play a crucial structural role, as demonstrated in reconstitution studies of related proteins where lutein was the only carotenoid necessary for successful reconstitution

Energy transfer optimization:

  • Precise positioning of pigments through specific amino acid interactions creates optimal distances and orientations for efficient energy transfer

  • The protein scaffold maintains these spatial relationships to ensure rapid energy migration from chlorophyll b to chlorophyll a

  • Specific amino acids create an environment that tunes the energy levels of bound pigments

Structure-function relationships:

Understanding these specific amino acid contributions provides insights for protein engineering approaches aimed at modifying spectral properties or enhancing photosynthetic efficiency.

What experimental approaches can resolve the chromophore organization within recombinant Cucumis sativus LHCII Type 1?

Resolving the chromophore organization within recombinant Cucumis sativus LHCII Type 1 requires multiple complementary experimental approaches that can provide information about pigment identity, stoichiometry, binding sites, and energy transfer pathways:

Pigment identification and quantification:

  • High-performance liquid chromatography (HPLC):

    • Separates and identifies individual pigments

    • Determines precise pigment stoichiometry

    • Can be coupled with mass spectrometry for definitive identification

  • Absorption spectroscopy:

    • Provides information about pigment composition

    • Characteristic peaks identify different chlorophylls and carotenoids

    • Can detect shifts in absorption maxima due to protein environment

Spatial organization and energetic coupling:

  • Linear and circular dichroism spectroscopy:

    • Provides information about orientation of pigment transition dipoles

    • Reveals excitonic interactions between pigments

  • Time-resolved fluorescence spectroscopy:

    • Measures energy transfer kinetics between pigments

    • Identifies energy transfer pathways

    • Determines efficiency of excitation energy transfer

  • Transient absorption spectroscopy:

    • Tracks energy transfer events with femtosecond time resolution

    • Provides information about excited state dynamics

Site-specific information:

  • Site-directed mutagenesis combined with spectroscopy:

    • Systematic mutation of putative pigment-binding residues

    • Analysis of spectral changes reveals role of specific amino acids

    • Can identify critical residues for binding particular pigments

  • Resonance Raman spectroscopy:

    • Provides vibrational information about specific pigments within the complex

    • Can distinguish between different binding environments

  • Selective pigment reconstitution:

    • Reconstitution with defined pigment mixtures

    • Analysis of successfully assembled complexes reveals binding selectivity

    • Studies with CP29 demonstrated that pigment composition of reconstituted protein depends on pigments present in the reconstitution mixture

These approaches collectively provide a comprehensive view of chromophore organization, essential for understanding the structure-function relationship in LHCII proteins.

How can recombinant Cucumis sativus LHCII Type 1 be used to study light-harvesting regulation mechanisms?

Recombinant Cucumis sativus LHCII Type 1 serves as a powerful model system for studying light-harvesting regulation mechanisms that are central to plant photosynthetic efficiency and adaptation. Several experimental approaches utilizing this recombinant protein can provide insights into these regulatory processes:

Investigation of transcriptional regulation:

  • Electrophoretic Mobility Shift Assay (EMSA):

    • Identifies transcription factors that bind to the promoter region of LHCII genes

    • Can determine sequence-specific DNA-protein interactions

    • This approach has been successfully used to study HY5 binding to promoters of light-harvesting complex genes in related systems

  • Dual-luciferase assays:

    • Quantifies promoter activity in response to different transcription factors

    • The promoters of LHC genes can be ligated into reporter vectors (e.g., pGreenII-0800-LUC)

    • Transcription factors can be expressed from effector plasmids (e.g., pGreenII-0029-62-SK)

    • This system has been used to study transcriptional regulation of LHC genes in related plants

Post-translational regulation studies:

  • Phosphorylation analysis:

    • Reconstituted LHCII can be used as substrate for kinases

    • Phosphorylation state can be monitored by mass spectrometry or phospho-specific antibodies

    • Changes in spectroscopic properties upon phosphorylation can be measured

  • Protein-protein interaction assays:

    • Yeast two-hybrid or pull-down assays to identify regulatory proteins

    • Surface plasmon resonance to quantify binding affinities

    • Co-immunoprecipitation to verify interactions in planta

Environmental response mechanisms:

  • In vitro quenching measurements:

    • Reconstituted LHCII can be used to study non-photochemical quenching mechanisms

    • Effects of pH, zeaxanthin binding, and protein conformational changes can be assessed

    • Fluorescence lifetime measurements reveal quenching efficiency

  • Light quality response:

    • Analysis of LHCII expression in response to different light qualities

    • Studies in related systems have shown that light quality regulates LHC expression through photoreceptor-dependent pathways involving HY5

These approaches provide mechanistic insights into how plants regulate light harvesting in response to changing environmental conditions, with implications for improving crop photosynthetic efficiency.

What role does LHCII Type 1 play in the dynamic regulation of photosystem organization under varying light conditions?

LHCII Type 1 plays a crucial role in the dynamic regulation of photosystem organization, contributing to the plant's ability to optimize photosynthesis under varying light conditions. This regulation involves several mechanisms that can be studied using recombinant Cucumis sativus LHCII:

State transitions and energy distribution:

  • Redistributing excitation energy between photosystems:

    • Under light conditions favoring Photosystem I (PSI), LHCII can be phosphorylated and migrate from PSII to PSI

    • This movement balances excitation energy between the photosystems

    • Recombinant LHCII can be used to study the molecular determinants of this migration

  • Phosphorylation-dependent conformational changes:

    • Specific threonine residues in LHCII become phosphorylated by the STN7 kinase

    • This phosphorylation triggers structural changes that affect protein-protein interactions

    • Recombinant LHCII variants with modified phosphorylation sites can reveal the importance of these residues

Supramolecular organization:

  • LHCII trimers vs. monomers:

    • LHCII Type 1 can form stable trimers that associate with PSII in different arrangements

    • The oligomerization state affects energy transfer properties and membrane organization

    • Reconstituted recombinant LHCII can be used to study factors influencing trimer formation

  • Megacomplex formation:

    • LHCII contributes to the formation of PSII-LHCII supercomplexes

    • These supercomplexes organize into larger arrays in the thylakoid membrane

    • Structural studies with recombinant proteins can reveal the molecular interfaces involved

High light response:

  • Non-photochemical quenching (NPQ):

    • LHCII undergoes conformational changes that convert it from a light-harvesting to an energy-dissipating state

    • This process involves interactions with PsbS protein and xanthophyll cycle carotenoids

    • Reconstituted LHCII can be used to study the molecular mechanisms of NPQ in vitro

  • Regulatory gene expression:

    • Expression of LHCII is downregulated under high light conditions

    • This regulation may involve transcription factors that respond to light quality

    • Studies in related systems show that light quality regulates plant biomass and fruit quality through photoreceptor-dependent pathways involving HY5-LHC modules

Understanding these dynamic regulatory mechanisms provides insights into how plants balance efficient light harvesting with photoprotection under varying environmental conditions.

How can modifications to LHCII Type 1 advance our understanding of photosynthetic efficiency in Cucumis sativus?

Strategic modifications to LHCII Type 1 can significantly advance our understanding of photosynthetic efficiency in Cucumis sativus, providing insights that may lead to improved crop productivity. Several approaches to protein modification offer valuable research opportunities:

Site-directed mutagenesis approaches:

  • Alteration of pigment-binding residues:

    • Systematic mutation of amino acids coordinating chlorophylls and carotenoids

    • Analysis of resulting spectral changes and energy transfer efficiency

    • Identification of critical residues for optimal light harvesting

  • Modification of phosphorylation sites:

    • Mutation of threonine residues involved in state transitions

    • Creation of phosphomimetic variants (e.g., T→D substitutions)

    • Assessment of effects on protein-protein interactions and membrane dynamics

  • Introduction of spectral tuning mutations:

    • Targeted changes to alter the protein environment around specific pigments

    • Shifting of absorption spectra to better match available light in different growth conditions

    • Evaluation of resulting changes in energy transfer efficiency

Pigment modification strategies:

  • Reconstitution with altered pigment compositions:

    • Varying chlorophyll a/b ratios to optimize light absorption

    • Incorporation of different carotenoids to enhance photoprotection

    • Studies with related proteins have shown that the pigment composition of reconstituted protein depends on pigments present in the reconstitution mixture

  • Introduction of non-native chromophores:

    • Reconstitution with synthetic or modified tetrapyrroles

    • Extension of spectral range of light harvesting

    • Assessment of energy transfer efficiency with novel chromophores

Protein engineering approaches:

  • Domain swapping with other LHC proteins:

    • Creation of chimeric proteins combining features of LHCII with other antenna complexes

    • Identification of regions responsible for specific functional properties

    • Optimization of both light harvesting and photoprotection capabilities

  • Stability engineering:

    • Enhancement of protein thermal stability while maintaining function

    • Improvement of resistance to photodamage

    • Development of variants with enhanced performance under stress conditions

These modification approaches provide powerful tools for understanding structure-function relationships in LHCII and may ultimately contribute to strategies for improving photosynthetic efficiency in cucumber and other crops.

How can genome editing techniques be applied to study LHCII Type 1 function in Cucumis sativus?

Genome editing techniques offer powerful approaches for studying LHCII Type 1 function in Cucumis sativus, enabling precise genetic modifications that reveal functional roles and regulatory mechanisms. Several strategies can be implemented using these advanced technologies:

CRISPR-Cas9 gene editing applications:

  • Gene knockout studies:

    • Complete elimination of LHCII Type 1 expression

    • Assessment of photosynthetic parameters in knockout plants

    • Analysis of compensatory mechanisms involving other LHC proteins

    • Evaluation of effects on plant growth and development

  • Promoter editing:

    • Modification of regulatory elements controlling LHCII expression

    • Introduction of mutations in transcription factor binding sites

    • Analysis of resulting changes in expression patterns

    • Identification of key regulators similar to the HY5-LHC regulatory module observed in related systems

  • Base editing and prime editing:

    • Introduction of specific amino acid substitutions without double-strand breaks

    • Creation of variants with altered pigment binding properties

    • Modification of regulatory sites (e.g., phosphorylation sites)

    • Fine-tuning of protein-protein interaction domains

Advanced phenotyping of edited plants:

  • High-throughput photosynthetic analysis:

    • Chlorophyll fluorescence imaging to assess PSII efficiency

    • Gas exchange measurements to quantify carbon assimilation

    • Spectroscopic analysis of antenna size and excitation energy transfer

    • Growth and yield measurements under various light conditions

  • Molecular phenotyping:

    • Proteomics to assess changes in thylakoid protein composition

    • Transcriptomics to identify compensatory gene expression

    • Metabolomics to evaluate effects on carbon metabolism

    • Analysis of protein complexes by native gel electrophoresis

Integration with genomic resources:

  • Utilization of cucumber genome information:

    • The B10v3 cucumber genome, with 98% of protein-coding genes assigned to chromosomes, provides a valuable resource for targeting specific LHCII loci

    • Comparative genomics with other cucumber lines (e.g., 9930, Gy14) can identify natural variation in LHCII genes

    • Analysis of chromosomal context and potential regulatory elements

These genome editing approaches, combined with comprehensive phenotyping, provide unprecedented opportunities to understand LHCII function in the context of the whole plant, revealing both direct and pleiotropic effects of modifications to the light-harvesting apparatus.

What recent discoveries have improved our understanding of transcriptional regulation of LHCII Type 1 in Cucumis sativus?

Recent discoveries have significantly enhanced our understanding of the transcriptional regulation of LHCII Type 1 in Cucumis sativus and related species, revealing complex regulatory networks that control expression in response to developmental and environmental cues:

Transcription factor networks:

  • HY5-mediated light signaling:

    • The transcription factor HY5 (ELONGATED HYPOCOTYL5) directly regulates LHC gene expression

    • HY5 binds to promoters of LHC genes, as demonstrated through electrophoretic mobility shift assays (EMSA)

    • In related systems, dual-luciferase assays have confirmed HY5 activation of LHC promoters

    • Light quality regulates plant development through this photoreceptor-dependent HY5-LHC module

  • MYB transcription factors:

    • In Cucumis sativus, CsMYB60 has been identified as a key transcriptional regulator

    • CsMYB60 directly activates target genes by binding to their promoters

    • This transcription factor can promote the expression of other regulatory components, forming a transcriptional cascade

    • Similar mechanisms may regulate LHCII expression in cucumber

Regulatory complexes and cofactors:

  • Transcriptional complexes:

    • Formation of regulatory complexes involving multiple proteins

    • In cucumber, CsMYB60 directly or indirectly promotes the expression of CsbHLH42, CsMYC1, and CsWD40

    • These proteins can form complexes that regulate gene expression

    • Interaction with the TATA-box binding protein further modulates transcription

  • Chromatin-level regulation:

    • Histone modifications influence accessibility of LHC gene promoters

    • Light-dependent changes in chromatin structure affect transcription factor binding

    • Epigenetic mechanisms contribute to long-term adaptation of expression patterns

Environmental response mechanisms:

  • Light quality sensing:

    • Different photoreceptors (phytochromes, cryptochromes) perceive specific wavelengths

    • These receptors trigger signaling cascades that ultimately regulate LHC expression

    • Studies in related systems demonstrate that light quality regulates LHC expression through photoreceptor-dependent pathways

  • Integration of multiple signals:

    • Nutritional status affects LHC expression through metabolic signaling

    • Stress conditions modulate expression via hormone-responsive elements

    • Developmental stage influences baseline expression levels

Understanding these regulatory mechanisms provides insights into how plants optimize their light-harvesting capacity in response to environmental conditions, with implications for improving crop performance under variable light regimes.

How are advanced biophysical techniques enhancing our understanding of energy transfer dynamics in LHCII Type 1?

Advanced biophysical techniques are revolutionizing our understanding of energy transfer dynamics in LHCII Type 1, providing unprecedented insights into the ultrafast processes that underlie efficient light harvesting. These cutting-edge approaches reveal the molecular mechanisms of energy capture, transfer, and dissipation:

Ultrafast spectroscopy techniques:

  • Two-dimensional electronic spectroscopy (2DES):

    • Maps energy transfer pathways with femtosecond time resolution

    • Reveals electronic couplings between pigments

    • Distinguishes between different energy transfer mechanisms

    • Provides information about quantum coherence effects

  • Transient absorption spectroscopy:

    • Tracks excited state dynamics from femtoseconds to nanoseconds

    • Monitors energy migration between different pigment pools

    • Identifies bottlenecks in energy transfer

    • Measures the effects of protein environment on energy transfer rates

  • Time-resolved fluorescence spectroscopy:

    • Measures fluorescence lifetimes with picosecond resolution

    • Quantifies energy transfer efficiency under different conditions

    • Identifies quenching sites and mechanisms

    • Monitors conformational changes affecting energy pathways

Single-molecule techniques:

  • Single-molecule fluorescence spectroscopy:

    • Reveals heterogeneity in protein behavior masked in ensemble measurements

    • Captures rare or transient conformational states

    • Monitors dynamic fluctuations in energy transfer pathways

    • Provides insights into the stochastic nature of photosynthetic processes

  • Single-protein manipulation:

    • Atomic force microscopy to measure mechanical properties

    • Optical tweezers to apply controlled forces

    • Correlates structural dynamics with functional states

Advanced structural methods:

  • Time-resolved X-ray techniques:

    • X-ray free-electron lasers capture structural dynamics

    • Pump-probe experiments correlate structure with function

    • Reveals conformational changes associated with energy transfer and quenching

  • Computational methods integrated with experimental data:

    • Quantum chemical calculations of excitonic interactions

    • Molecular dynamics simulations of protein dynamics

    • Multiscale modeling approaches combining quantum and classical descriptions

    • Structure-based calculations of energy transfer rates

These advanced techniques have revealed several key insights about LHCII function:

  • Quantum coherence may contribute to the efficiency of energy transfer

  • Dynamic protein motions modulate pigment-pigment interactions

  • Multiple conformational states exist with different energy transfer properties

  • Specific pigment-protein interactions fine-tune energy levels for optimal transfer

By applying these cutting-edge approaches to recombinant Cucumis sativus LHCII Type 1, researchers can uncover the molecular details of photosynthetic light harvesting with unprecedented resolution.

What strategies can address protein aggregation challenges during recombinant LHCII Type 1 expression and purification?

Protein aggregation represents a significant challenge during recombinant LHCII Type 1 expression and purification, potentially compromising yield, structure, and functionality. Several strategic approaches can effectively address these challenges:

Expression optimization strategies:

  • Temperature modulation:

    • Lowering growth temperature (16-20°C) during induction slows protein synthesis

    • Slower synthesis allows more time for proper folding or inclusion body formation

    • Reduced proteolytic degradation of misfolded proteins

  • Induction optimization:

    • Using lower concentrations of inducer (IPTG)

    • Employing alternative promoters with more moderate expression rates

    • Implementing auto-induction media for gradual protein expression

  • Co-expression with molecular chaperones:

    • GroEL/GroES system assists protein folding

    • DnaK/DnaJ/GrpE chaperone system prevents aggregation

    • Trigger factor aids co-translational folding

Purification approaches for aggregation prevention:

  • Optimized solubilization conditions:

    • Systematic screening of detergents (e.g., β-DDM, LDAO, OG)

    • Inclusion of specific lipids that stabilize membrane proteins

    • Optimization of pH and ionic strength to maintain protein solubility

  • Addition of stabilizing agents:

    • Glycerol (10-20%) to prevent hydrophobic aggregation

    • Arginine to suppress protein-protein interactions

    • Specific pigments that may stabilize protein structure

  • Size exclusion chromatography with multi-angle light scattering (SEC-MALS):

    • Monitors aggregation state during purification

    • Allows selection of optimal buffer conditions

    • Provides quality control for subsequent experiments

Reconstitution optimization:

  • Controlled refolding protocols:

    • Gradual removal of denaturants through dialysis

    • Step-wise addition of pigments during refolding

    • Fine-tuning of detergent concentration during reconstitution

  • Pigment composition adjustments:

    • Inclusion of lutein, which plays a crucial structural role in LHC proteins

    • Optimization of chlorophyll a/b ratio in the reconstitution mixture

    • Sequential addition of different pigment types

These approaches can significantly reduce aggregation issues, improving both yield and quality of recombinant LHCII Type 1 protein for structural and functional studies.

How can researchers troubleshoot pigment binding issues in reconstitution experiments with recombinant LHCII Type 1?

Troubleshooting pigment binding issues in reconstitution experiments with recombinant LHCII Type 1 requires a systematic approach to identify and address the specific factors limiting successful chromophore incorporation:

Diagnostic approaches to identify binding issues:

Methodological solutions for common issues:

  • Addressing protein denaturation:

    • Optimize detergent type and concentration during reconstitution

    • Include stabilizing agents (glycerol, specific lipids)

    • Control temperature during the reconstitution process

    • Consider step-wise addition of pigments

  • Improving pigment solubility and availability:

    • Prepare fresh pigment stocks to avoid oxidation

    • Ensure complete solubilization of pigments in organic solvent

    • Control the rate of pigment addition to the protein solution

    • Optimize pH and ionic strength of reconstitution buffer

  • Ensuring proper pigment composition:

    • Include lutein, which plays a crucial structural role in LHC proteins

    • Maintain appropriate chlorophyll a/b ratio

    • Consider that different LHC proteins may have different pigment preferences

    • Studies with related proteins have shown that the pigment composition of reconstituted protein depends on pigments present in the reconstitution mixture

  • Addressing protein aggregation during reconstitution:

    • Monitor light scattering during the reconstitution process

    • Optimize protein concentration (typically 0.5-1 mg/ml)

    • Include mild solubilizing agents to prevent hydrophobic aggregation

    • Control the rate of detergent removal if applicable

Based on experience with related proteins like CP29, successful reconstitution should yield pigment-protein complexes with biochemical and spectral properties similar to the native protein isolated from plant thylakoids .

What experimental strategies can resolve contradictory data on LHCII Type 1 structure-function relationships?

Resolving contradictory data on LHCII Type 1 structure-function relationships requires robust experimental strategies that address variability, validate observations across multiple systems, and reconcile apparently conflicting results:

Sources of experimental variability and contradiction:

  • Heterogeneity in protein preparations:

    • Variations in pigment composition affecting spectroscopic properties

    • Differences in post-translational modifications

    • Presence of multiple conformational states

  • Methodological differences:

    • Variations in reconstitution protocols affecting protein folding

    • Different detergent environments influencing protein structure

    • Various measurement conditions (temperature, pH, ionic strength)

  • Species-specific differences:

    • Variations in primary sequence between Cucumis sativus and other species

    • Differences in natural pigment composition

Resolution strategies:

  • Standardization of experimental systems:

    • Establish well-defined protocols for protein expression and purification

    • Implement quality control measures for assessing protein integrity

    • Develop standard reconstitution conditions that can be reproduced across laboratories

    • Create reference samples for calibration of analytical instruments

  • Multi-technique validation:

    • Apply complementary methods to address the same question

    • Example: Combine spectroscopic, biochemical, and structural approaches

    • Correlate functional measurements with structural assessments

    • Implement both in vitro and in vivo validation where possible

  • Systematic mutagenesis studies:

    • Create a library of single-site mutations to test specific hypotheses

    • Perform alanine-scanning mutagenesis of regions with contradictory functional assignments

    • Introduce mutations that specifically test competing structural models

    • Assess multiple functional parameters for each mutant

  • Controlled manipulation of experimental variables:

    • Systematically vary reconstitution conditions to identify sources of variability

    • Test multiple pigment combinations to assess the influence of chromophore composition

    • Studies with related proteins have shown that the pigment composition of reconstituted protein depends on pigments present in the reconstitution mixture

  • Meta-analysis of published data:

    • Compile and systematically analyze published results

    • Identify patterns in data that may explain apparent contradictions

    • Develop unified models that accommodate seemingly conflicting observations

By implementing these strategies, researchers can resolve contradictions and develop a more coherent understanding of structure-function relationships in Cucumis sativus LHCII Type 1, advancing both basic photosynthesis research and potential applications in crop improvement.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.