Recombinant Cucumis sativus Chlorophyll a-b binding protein of LHCII type I, chloroplastic

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Chlorophyll a-b binding protein of LHCII type I, chloroplastic; CAB; LHCP; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
26-255
Protein Length
Full Length of Mature Protein
Species
Cucumis sativus (Cucumber)
Target Protein Sequence
RKTASKSVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNR ELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQ SILAIWACQVVLMGAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAFAELKVKELK NGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Uniprot No.

Target Background

Function
The light-harvesting complex (LHC) acts as a light receptor, capturing and transferring excitation energy to associated photosystems.
Protein Families
Light-harvesting chlorophyll a/b-binding (LHC) protein family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and composition of Cucumis sativus Chlorophyll a-b Binding Protein of LHCII Type I?

The Cucumis sativus Chlorophyll a-b Binding Protein of LHCII Type I is a membrane-bound protein primarily located in the chloroplast. The mature protein spans from amino acids 26-255 of the full-length sequence . It contains multiple transmembrane regions, with specific peptide regions like WAMLGALGCVFPELLSR spanning transmembrane domains . Structurally, the protein contains binding sites for both chlorophyll a and chlorophyll b molecules, which are critical for its function in light harvesting.

When working with this protein, researchers should note that its membrane-bound nature makes it challenging to isolate without specialized techniques. Experimental protocols typically require detergents and sonication to effectively extract the protein while maintaining its structural integrity. Most recombinant versions, such as those available commercially, are produced in E. coli expression systems with His-tag modifications to facilitate purification .

How does the LHCII protein function within the photosynthetic apparatus?

The chlorophyll a-b binding protein functions as a critical component of the light-harvesting complex II (LHCII) in plants. Its primary role is to capture photons and transfer excitation energy to the photosystem reaction centers. The protein binds multiple chlorophyll molecules (both a and b types) and various carotenoids, which together optimize light absorption across different wavelengths of the visible spectrum.

The protein participates in both primary light-harvesting functions and photoprotective mechanisms. Under high light conditions, LHCII proteins undergo conformational changes that facilitate energy dissipation as heat, protecting the photosynthetic apparatus from photodamage. This non-photochemical quenching (NPQ) represents a critical physiological adaptation in plants. Researchers studying stress physiology or photosynthetic efficiency should consider this dual functionality when designing experiments with this protein.

What are the optimal conditions for recombinant expression and purification of Cucumis sativus Chlorophyll a-b Binding Protein?

For optimal recombinant expression of Cucumis sativus Chlorophyll a-b Binding Protein, E. coli is the preferred expression system, as demonstrated in multiple studies . The protein should be expressed with an affinity tag (typically His-tag) to facilitate purification. Key methodological considerations include:

  • Expression vector selection: Vectors containing T7 promoters with IPTG induction capability provide good control over expression timing and level.

  • Expression conditions: Optimize by testing various temperatures (typically 16-25°C), IPTG concentrations (0.1-1.0 mM), and induction times (4-16 hours).

  • Purification protocol:

    • Cell lysis: Use detergent-based methods with sonication to effectively solubilize the membrane-associated protein

    • Buffer composition: Include glycerol (10-15%) to improve stability

    • Purification steps: Metal affinity chromatography, followed by size exclusion chromatography

  • Quality control: Assess purity using SDS-PAGE and functionality through pigment binding assays

Researchers should be aware that the membrane-bound nature of this protein makes it particularly challenging to isolate without appropriate detergents. Successful protocols often incorporate detergents not only for solubilization but also for removing potential endotoxin contamination .

How can researchers effectively verify the functional activity of purified recombinant Chlorophyll a-b Binding Protein?

Verifying the functional activity of purified recombinant Chlorophyll a-b Binding Protein requires multiple complementary approaches:

  • Pigment binding assessment: The most direct functional test is to determine whether the recombinant protein can bind chlorophyll molecules and other tetrapyrroles. This can be assessed through:

    • Absorbance spectroscopy: Functional protein will exhibit characteristic absorbance peaks when bound to chlorophyll (~670-680 nm)

    • Difference spectroscopy: Compare bound versus free pigment spectra to confirm binding

  • Protein-protein interaction assays: Test interactions with known binding partners such as:

    • Other LHCII components

    • Regulatory proteins like GUN4 (which influences magnesium chelatase activity)

  • Enzymatic activity assays: For proteins like CabBP that influence enzymatic activities:

    • Monitor effects on magnesium chelatase activity by measuring MgPPIX formation through fluorescence

    • Assess activity using recombinant enzymatic systems reconstructed in vitro

  • Circular dichroism: Verify proper protein folding, especially important for membrane proteins

When evaluating activity, it's essential to include appropriate positive and negative controls. For example, when testing bilin binding, researchers have used known bilin-binding proteins such as Dolichomastix tenuilepis phytochrome (DtenPHY1) as positive controls .

What experimental approaches can elucidate the interaction between Chlorophyll a-b Binding Proteins and other photosynthetic components?

Understanding the interactions between Chlorophyll a-b Binding Proteins and other photosynthetic components requires sophisticated biophysical and biochemical techniques:

  • Co-immunoprecipitation (Co-IP) with crosslinking:

    • Utilize chemical crosslinkers to capture transient interactions

    • Employ tagged versions of the protein for specific pulldown

    • Identify interacting partners through mass spectrometry

  • Förster Resonance Energy Transfer (FRET):

    • Tag potential interacting partners with appropriate fluorophores

    • Measure energy transfer as evidence of proximity and interaction

    • Particularly useful for mapping the location of the protein within photosystem complexes

  • Native gel electrophoresis and blue native PAGE:

    • Preserve protein-protein interactions during separation

    • Identify intact complexes containing the Chlorophyll a-b Binding Protein

  • Reconstitution in liposomes or nanodiscs:

    • Create minimal systems to study protein function in a membrane environment

    • Test specific interactions in isolation from other cellular components

  • Single-molecule techniques:

    • Apply single-molecule FRET to observe dynamic interactions

    • Use atomic force microscopy to visualize protein complexes at nanoscale resolution

Recent research has employed modified immunoprecipitation techniques to discover novel interactions, such as the binding between chlorophyll a-b binding protein AB96 and TGFβ1, which was initially identified using biotinylated active TGFβ1 as bait .

How do bilins interact with Chlorophyll a-b Binding Proteins and what methodologies best capture these interactions?

The interaction between bilins and Chlorophyll a-b Binding Proteins represents an emerging area of research with significant implications for understanding photosynthetic regulation. Based on studies with related proteins like GUN4, the following methodologies have proven effective:

  • In vitro binding assays:

    • Co-express the protein with bilin biosynthesis plasmids in E. coli

    • Observe visual color changes in cell pellets and purified protein as initial evidence of binding

    • Measure absorption spectra of protein-bilin complexes, noting characteristic shifts in absorption maxima compared to free bilins

  • Difference spectroscopy:

    • Calculate bound-minus-free pigment difference spectra to quantify spectral shifts

    • For example, when bilins like phycocyanobilin (PCB) bind to similar proteins, absorption maxima shift to ~370 and ~670-674 nm

    • Biliverdin (BV) binding typically produces shifts to ~380-382 and ~691-705 nm

  • Functional impact assessments:

    • Measure the effect of bilin binding on enzymatic activities

    • For example, test how bilin binding affects magnesium chelatase activity using fluorescence-based assays to quantify MgPPIX formation

  • Kinetic analyses:

    • Determine binding affinities through titration experiments

    • Analyze the effect of bilin binding on substrate affinity and enzymatic efficiency

  • Chemical complementation:

    • Use exogenous bilin feeding experiments to rescue mutant phenotypes

    • For example, biliverdin feeding can restore chlorophyll accumulation in bilin-deficient mutants

The experimental evidence indicates that bilin binding can significantly influence enzymatic activities, with studies showing up to 20-fold stimulation of magnesium chelatase activity in the presence of phycocyanobilin .

What evidence exists for the role of Chlorophyll a-b Binding Proteins in cytokine binding and what are the implications for cross-kingdom signaling?

Recent research has revealed an unexpected role for Chlorophyll a-b Binding Proteins in cytokine binding, particularly the interaction with active TGFβ1. This discovery has significant implications for understanding cross-kingdom signaling and potential medicinal applications:

  • Discovery methodology: The interaction was serendipitously discovered when Vernonia amygdalina extract was found to bind to and functionally inhibit active TGFβ1. Subsequent isolation identified chlorophyll a-b binding protein AB96 as the binding agent .

  • Experimental verification:

    • Modified immunoprecipitation using biotinylated active TGFβ1 as bait

    • Mass spectrometric analysis identifying peptides EVIHSRWAMLGALGCVFPELLSR and FGEAVWFK from chlorophyll a-b binding protein

    • Confirmation using recombinant full-length folded CabBP AB96 from Pisum sativum

    • Functional assays using luciferase reporter systems to verify inhibition of TGFβ1 activity

  • Significance: This represents the first plant-derived cytokine-neutralizing protein to be described in scientific literature .

  • Research implications:

    • Challenges conventional understanding of plant protein functions

    • Suggests evolutionary convergence or adaptation of photosynthetic proteins for immune modulation

    • May explain some of the medicinal benefits observed with traditional plant remedies

  • Methodological approach for similar discoveries:

    • Screen plant extracts for binding to mammalian signaling molecules

    • Use biotinylated bait proteins and streptavidin beads for pulldown assays

    • Employ mass spectrometry for protein identification

    • Confirm with recombinant proteins and functional assays

This emerging research area suggests that chlorophyll-binding proteins may play previously unrecognized roles in interspecies communication and immune modulation.

How does the stability of Chlorophyll a-b Binding Proteins compare across different species and what methods reveal these differences?

Understanding stability differences in Chlorophyll a-b Binding Proteins across species requires systematic comparative analyses:

  • Thermal stability assessment:

    • Differential scanning calorimetry (DSC) to determine melting temperatures

    • Circular dichroism (CD) spectroscopy with thermal ramping

    • Fluorescence-based thermal shift assays for high-throughput screening

  • Proteolytic susceptibility:

    • Limited proteolysis followed by mass spectrometry

    • Pulse-chase experiments to determine protein half-life in vivo

    • Comparison of degradation patterns across species

  • Photooxidative stability:

    • Light exposure experiments under controlled conditions

    • Measurement of protein loss and modification using immunoblotting

    • Assessment of protective mechanisms like bilin binding

  • Species-specific variations:

    • Evidence suggests significant differences between monocots and eudicots in terms of protein stability and bilin binding capacity

    • Monocots appear to have less capacity for TGFβ1 binding despite expressing chlorophyll a-b binding proteins

    • This may be due to differences in vascular tissue proportion and consequently lower amounts of chlorophyll-binding proteins in monocots

  • Experimental design considerations:

    • Control for tissue types when comparing across species

    • Account for developmental stages as protein stability may vary

    • Consider expression levels and protein abundance in comparative analyses

Research indicates that stability is influenced by interactions with other molecules, with studies showing that bilins can protect chlorophyll-binding proteins from photooxidative damage and turnover in light conditions .

How can researchers address common challenges in working with recombinant Chlorophyll a-b Binding Proteins?

Working with recombinant Chlorophyll a-b Binding Proteins presents several challenges that researchers should anticipate and address:

  • Solubility issues:

    • Challenge: As membrane proteins, they often form inclusion bodies or aggregate

    • Solution: Optimize expression conditions (lower temperature, reduced induction)

    • Method: Use fusion partners that enhance solubility (MBP, SUMO, thioredoxin)

    • Approach: Incorporate detergents during purification (CHAPS, DDM, or Triton X-100)

  • Protein stability:

    • Challenge: Rapid degradation during purification

    • Solution: Work at 4°C, add protease inhibitors, minimize freeze-thaw cycles

    • Method: Include stabilizing agents (glycerol 10-15%, specific lipids)

    • Approach: Verify stability using time-course SDS-PAGE analysis

  • Co-factor binding:

    • Challenge: Recombinant protein may lack chlorophyll or other tetrapyrroles

    • Solution: Reconstitute with purified pigments post-expression

    • Method: Monitor binding spectroscopically (absorption at 370-380 nm and 670-705 nm)

    • Approach: Verify functionality through enzymatic assays

  • Functional verification:

    • Challenge: Confirming proper folding and activity

    • Solution: Compare with native protein extracted from plant material

    • Method: Use multiple complementary assays (pigment binding, protein interactions)

    • Approach: Include appropriate positive and negative controls in all assays

  • Experimental data contradictions:

    • Challenge: Conflicting results between in vitro and in vivo experiments

    • Solution: Carefully document experimental conditions and protein preparations

    • Method: Test multiple protein batches and experimental approaches

    • Approach: Consider species differences when comparing to literature data

When assessing protein stability and accumulation, immunoblot analysis using specific antibodies against the protein of interest and other pathway components provides valuable comparative data, as demonstrated in studies of related chlorophyll-binding proteins .

What analytical techniques best resolve contradictory data in Chlorophyll a-b Binding Protein research?

When facing contradictory data in Chlorophyll a-b Binding Protein research, systematic analytical approaches help resolve discrepancies:

  • Protein characterization verification:

    • Mass spectrometry to confirm protein identity and detect modifications

    • Size exclusion chromatography to assess oligomeric state

    • Circular dichroism to verify secondary structure elements

    • These approaches can identify if structural differences explain functional variation

  • Functional assay standardization:

    • Establish dose-response relationships for all activities

    • Determine the effect of buffer conditions on activity measurements

    • Use enzymatic assays with purified components to eliminate confounding factors

    • For example, in magnesium chelatase activity assays, controlling for fixed concentrations of CHLI and CHLD subunits is critical

  • Statistical approaches for reconciling data:

    • Power analysis to determine appropriate sample sizes

    • Meta-analysis techniques to combine results from multiple experiments

    • Bayesian methods to incorporate prior knowledge with new data

  • Controls for experimental variables:

    • Light conditions: Both quality and quantity affect protein stability

    • Genetic background: Compare results across multiple strains and species

    • Developmental stage: Document the growth phase and physiological state

  • Methodological triangulation:

    • Employ multiple independent techniques to measure the same parameter

    • For tetrapyrrole binding, combine spectroscopic, chromatographic, and functional assays

    • For protein-protein interactions, use combinations of co-IP, crosslinking, and functional assays

When analyzing kinetic data, statistical models that account for cooperativity are essential. For example, studies of related proteins have shown sigmoidal kinetics with Hill coefficients around 3.0, indicating highly cooperative binding .

How might Chlorophyll a-b Binding Proteins be utilized in synthetic biology applications?

Chlorophyll a-b Binding Proteins offer several promising applications in synthetic biology:

  • Light-harvesting enhancements:

    • Engineering optimized versions with expanded spectral ranges

    • Incorporation into non-photosynthetic organisms to create light-responsive systems

    • Design of artificial antenna complexes with improved efficiency

  • Biosensor development:

    • Exploitation of tetrapyrrole binding properties for sensing applications

    • Creation of fluorescent reporters based on energy transfer principles

    • Development of biosensors for cytokine detection based on the TGFβ1 binding capability

  • Protein stability engineering:

    • Design of chimeric proteins incorporating stable domains from Chlorophyll a-b Binding Proteins

    • Investigation of bilin binding as a stability enhancement for recombinant proteins

    • Creation of photo-protective modules for light-sensitive enzymes

  • Therapeutic protein development:

    • Exploration of cytokine binding for anti-inflammatory applications

    • Design of plant-derived proteins that can modulate mammalian signaling pathways

    • Development of oral biologics leveraging the stability of plant proteins

  • Experimental methodologies for synthetic applications:

    • Directed evolution approaches to enhance desired properties

    • Computational protein design guided by structural insights

    • High-throughput screening methods for functional variants

The discovery that chlorophyll a-b binding protein AB96 can bind to and functionally inhibit active TGFβ1 opens entirely new avenues for biomedical applications that warrant further exploration .

What are the implications of GUN4 and bilin interactions for understanding evolutionary conservation of Chlorophyll a-b Binding Proteins?

The interactions between GUN4, bilins, and their effects on chlorophyll biosynthesis provide insights into the evolutionary conservation of photosynthetic proteins:

  • Dual regulatory mechanisms:

    • Research indicates that GUN4:bilin complexes play two critical roles: stimulating magnesium chelatase activity and protecting the CHLH subunit from photooxidative damage

    • This dual functionality likely explains the retention of bilin biosynthesis across all photosynthetic eukaryotes

  • Experimental approaches to study evolutionary conservation:

    • Comparative genomics to analyze sequence conservation across diverse photosynthetic species

    • Heterologous expression of proteins from different species to test functional conservation

    • Rescue experiments in mutants using proteins from evolutionary distant organisms

  • Methodological considerations for evolutionary studies:

    • Reconstruct ancestral protein sequences computationally

    • Express and test ancestral proteins for bilin binding and functional activities

    • Compare kinetic parameters across evolutionary diverse proteins

  • Data support for evolutionary significance:

    • The ability of GUN4 to bind bilins with high affinity is observed across species

    • The stimulation of MgCh activity by bilin binding to GUN4 represents a conserved regulatory mechanism

    • The protection of CHLH from photooxidative damage by GUN4:bilin complexes provides a selective advantage in oxygenic environments

  • Research implications:

    • The evolution of these interactions likely facilitated the adaptation to an illuminated oxic environment

    • Understanding these evolutionary adaptations may inform strategies for engineering improved photosynthetic efficiency

This evolutionary perspective provides a framework for understanding why specific protein-pigment interactions have been conserved throughout the diversification of photosynthetic organisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.