Recombinant Cucumis sativus Chloroplast envelope membrane protein (cemA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing the order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot the protein for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will determine the tag type during the production process. If you have specific tag type preferences, please inform us, and we will prioritize developing the specified tag.
Synonyms
cemA; CsCp052; Chloroplast envelope membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Cucumis sativus (Cucumber)
Target Names
cemA
Target Protein Sequence
MEKKKAFIPLLYLASIVFLPWWISLSFNKSLESWVTNWWNTGQSENFLNDIQEKSIIKKV LELEELFLLDEMLKEYPETHLQKLRIAISKETIQLIKMHNEDRIHTILHFSTNIICFVIL SGYSILGNEELVILNSWVQEFLYNLSDTIKAFSILLLTDLCIGFHSPHGWELMIGSVYKD FGFSHNDQIISSLVSTFPVILDTIFKYWIFRYLNRVSPSLVVIYHSLND
Uniprot No.

Target Background

Function
This protein may be involved in proton extrusion. It indirectly promotes efficient inorganic carbon uptake into chloroplasts.
Database Links

KEGG: csv:3429357

Protein Families
Cema family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.

Q&A

What is the chloroplast envelope membrane protein (cemA) and what is its role in Cucumis sativus?

The chloroplast envelope membrane protein (cemA) is a protein encoded by the chloroplast genome that localizes to the chloroplast envelope membrane in plants, including Cucumis sativus (cucumber). It plays essential roles in chloroplast function, particularly in CO₂ uptake across the chloroplast envelope and proton transport. In cucumber, cemA appears to be involved in photosynthetic efficiency and environmental stress responses, similar to its function in other plant species. Understanding cemA's specific roles in cucumber requires isolation and characterization through molecular approaches such as gene expression analysis, protein localization studies, and functional assays .

How does the structure of cemA in Cucumis sativus compare to other plant species?

The structural comparison of cemA across plant species, including Cucumis sativus, reveals conserved transmembrane domains that are critical for its function in the chloroplast envelope. Sequence alignment analysis typically shows highly conserved regions responsible for membrane insertion and functional domains involved in proton or ion transport. Researchers should employ bioinformatic tools to predict protein secondary structure, identify conserved motifs, and construct phylogenetic trees to understand evolutionary relationships. X-ray crystallography or cryo-electron microscopy would be required for detailed structural analysis, though these techniques present challenges with membrane proteins like cemA .

What experimental systems are available for studying recombinant cemA from Cucumis sativus?

Several experimental systems can be employed for studying recombinant Cucumis sativus cemA. The protein can be expressed in heterologous systems such as Escherichia coli, Pichia pastoris, or Nicotiana benthamiana leaves using appropriate expression vectors. For example, similar to the approach used for expressing cucumber vacuolar invertase (CsVI1), recombinant cemA can be purified from these systems for functional characterization . Expression in P. pastoris offers advantages for membrane proteins due to its eukaryotic protein processing capabilities. Alternatively, plant-based expression systems may better preserve native protein conformation and post-translational modifications. Researchers should carefully select expression tags and purification strategies that minimize interference with cemA's structure and function .

How can cemA gene expression be measured in cucumber tissues under different conditions?

cemA gene expression in cucumber tissues can be measured using several complementary techniques. Quantitative real-time PCR (qRT-PCR) offers a sensitive method for quantifying cemA transcript abundance, similar to the approach used for analyzing CsVI1 expression in cucumber seedlings under various conditions . RNA-seq provides a broader picture of gene expression changes, allowing researchers to identify co-expressed genes that may function together with cemA. Researchers should develop primers specific to cemA and validate them against the cucumber genome to ensure specificity. Proper experimental design includes appropriate reference genes for normalization, biological replicates (minimum 3-5), and controls for RNA quality. Analysis should account for tissue-specific expression patterns, as gene expression can vary significantly between different cucumber tissues and developmental stages .

What methods can be used to purify recombinant cemA protein from Cucumis sativus for functional studies?

Purification of recombinant cemA from Cucumis sativus requires specialized approaches for membrane proteins. A recommended protocol would begin with optimized expression in a suitable host system (E. coli, yeast, or plant-based), followed by membrane isolation through differential centrifugation. For cemA extraction, detergent solubilization using mild non-ionic detergents (DDM, LMNG, or digitonin) helps maintain protein structure. Affinity chromatography using N- or C-terminal tags (His6, FLAG, or Strep-tag II) can be employed for initial purification, followed by size exclusion chromatography to obtain homogeneous protein preparations. Researchers should consider incorporating stabilizing agents throughout the purification process and validate protein identity using mass spectrometry and Western blotting. Quality control should include assessment of protein folding through circular dichroism spectroscopy and thermal stability assays .

How does cemA respond to abiotic stress conditions in cucumber seedlings?

Investigation of cemA responses to abiotic stress in cucumber seedlings requires a multifaceted approach. Similar to studies on CsVI1 in cucumber under low temperature stress, researchers should expose cucumber seedlings to various abiotic stressors (cold, heat, drought, salinity) in controlled environments with appropriate controls . Transcript abundance can be measured using qRT-PCR at different time points after stress application, while protein levels should be assessed through Western blotting with specific antibodies. Protein localization changes can be monitored using fluorescently-tagged cemA variants and confocal microscopy. Functional responses may be evaluated through measurements of photosynthetic efficiency, chloroplast integrity, and metabolite profiles. Data should be analyzed through statistical methods including ANOVA with post-hoc tests to determine significant differences between treatments .

What protein-protein interactions does cemA form within the chloroplast envelope membrane complex?

Investigating cemA protein-protein interactions requires specialized techniques for membrane protein complexes. Co-immunoprecipitation using anti-cemA antibodies followed by mass spectrometry can identify interacting partners in native conditions. Split-ubiquitin or split-GFP yeast two-hybrid systems, which are adapted for membrane proteins, allow screening for specific protein interactions. Bimolecular fluorescence complementation (BiFC) in plant protoplasts or N. benthamiana leaves can confirm interactions in vivo. For structural studies of protein complexes, blue native PAGE followed by second-dimension SDS-PAGE separates intact complexes and identifies their components. Crosslinking mass spectrometry (XL-MS) can map interaction interfaces. Researchers should validate key interactions through multiple independent techniques and consider the dynamic nature of these interactions under different physiological conditions .

What is the role of post-translational modifications in cemA function in Cucumis sativus?

Post-translational modifications (PTMs) can significantly impact cemA function in cucumber. A comprehensive investigation would begin with mass spectrometry analysis of purified cemA to identify PTMs such as phosphorylation, acetylation, methylation, or glycosylation. Site-directed mutagenesis of identified PTM sites can determine their functional significance. Phosphorylation dynamics can be studied using phospho-specific antibodies or Phos-tag SDS-PAGE under different conditions. Researchers should employ enzymatic assays to measure cemA activity with and without specific PTMs, and use confocal microscopy with fluorescently-tagged cemA variants to determine if PTMs affect protein localization. Computational prediction tools can guide experimental design, but all predictions require experimental validation. The temporal aspects of PTMs during stress responses or developmental stages are particularly important to consider .

How can CRISPR-Cas9 genome editing be used to study cemA function in Cucumis sativus?

CRISPR-Cas9 genome editing offers powerful approaches for studying cemA function in cucumber. For successful implementation, researchers should design multiple guide RNAs targeting different regions of the cemA gene using cucumber chloroplast genome sequences and validated prediction tools to minimize off-target effects. Since cemA is chloroplast-encoded, specialized chloroplast transformation protocols must be employed rather than standard nuclear transformation methods. This requires biolistic delivery of CRISPR components into cucumber chloroplasts using gold particles coated with the CRISPR constructs. Phenotypic analysis of edited plants should include detailed photosynthetic measurements (O₂ evolution, chlorophyll fluorescence, CO₂ assimilation), ultrastructural analysis of chloroplasts using transmission electron microscopy, and metabolic profiling. Complementation experiments with wild-type cemA can confirm that observed phenotypes are specifically due to cemA modifications .

What expression systems are most suitable for producing functional recombinant Cucumis sativus cemA protein?

Selection of appropriate expression systems for recombinant cemA requires careful consideration of protein characteristics. E. coli systems using specialized strains (C41/C43, Lemo21) with modified promoters (T7, tac) and low expression temperatures (16-20°C) can improve membrane protein yields. Yeast systems (P. pastoris, S. cerevisiae) offer advantages through eukaryotic protein processing machinery and can be optimized using inducible promoters (AOX1, GAL1). Plant-based transient expression in N. benthamiana using Agrobacterium infiltration may better preserve native cemA conformation, similar to methods used for expressing CsVI1 . Cell-free systems provide another alternative, allowing direct incorporation into liposomes or nanodiscs. Researchers should compare protein yields, functionality, and structural integrity across multiple systems. Expression constructs should include purification tags positioned to minimize interference with protein folding and function, and codon optimization for the chosen expression host .

How can spectroscopic methods be applied to study the structural characteristics of purified cemA?

Spectroscopic methods provide valuable insights into cemA structural characteristics. Circular dichroism (CD) spectroscopy in the far-UV range (190-250 nm) can determine secondary structure content (α-helices, β-sheets), while near-UV CD (250-350 nm) reveals tertiary structure characteristics. Fourier-transform infrared spectroscopy (FTIR) offers complementary information about protein secondary structure, particularly useful for membrane proteins like cemA. Fluorescence spectroscopy using intrinsic tryptophan fluorescence or applied fluorescent probes can assess conformational changes under different conditions. For higher resolution structural analysis, nuclear magnetic resonance (NMR) spectroscopy of isotopically labeled cemA can provide atomic-level information about protein dynamics and ligand interactions. Researchers should prepare samples with minimal detergent concentrations to avoid interference with spectroscopic measurements and include appropriate buffer controls and reference proteins for accurate data interpretation .

What computational approaches can predict cemA function and interactions in Cucumis sativus?

Computational analysis of cemA begins with homology modeling based on structurally characterized homologs, using tools like SWISS-MODEL, Phyre2, or RoseTTAFold. Molecular dynamics simulations can predict cemA behavior within a lipid bilayer environment, revealing conformational changes and identifying potential functional sites. Protein-protein docking algorithms (HADDOCK, ClusPro) can predict interaction partners and binding interfaces, while computational mutagenesis assesses the impact of specific residue changes. Machine learning approaches integrated with structural predictions and sequence conservation analysis can predict functional motifs. Researchers should validate computational predictions through experimental approaches like site-directed mutagenesis and interaction studies. The analysis should incorporate cucumber-specific features such as chloroplast membrane composition and the unique physiological conditions of cucumber chloroplasts .

How can researchers resolve conflicting data about cemA localization in Cucumis sativus chloroplasts?

Resolving conflicting data about cemA localization requires a systematic approach combining multiple complementary techniques. Researchers should employ both biochemical fractionation (membrane vs. stromal fractions) and imaging techniques (confocal microscopy, immunogold electron microscopy) with appropriate controls. For biochemical approaches, multiple fractionation protocols should be compared, and cross-contamination between fractions must be assessed using established marker proteins for different chloroplast compartments. For imaging studies, both N- and C-terminal fluorescent protein fusions should be tested, as tag position can affect localization. Super-resolution microscopy techniques (STED, PALM) can provide higher spatial resolution. Independent antibody-based detection using multiple validated antibodies targeting different cemA epitopes can confirm results from tagged protein studies. Researchers should consider developmental stages and environmental conditions as potential sources of genuine variation in cemA localization patterns .

What statistical approaches are appropriate for analyzing cemA expression data across tissue types and stress conditions?

Statistical analysis of cemA expression requires careful experimental design and appropriate analytical methods. For comparing expression across multiple tissues or treatments, researchers should employ mixed-effects models that account for biological and technical replicates. When analyzing time-course data during stress responses, repeated measures ANOVA or time-series analysis methods are appropriate. Non-parametric tests should be considered when data doesn't meet assumptions of normality. Multiple testing corrections (Bonferroni, Benjamini-Hochberg) must be applied when comparing numerous conditions to control false discovery rates. Power analysis should guide sample size determination, typically requiring at least 3-5 biological replicates. Data visualization through principal component analysis or hierarchical clustering can reveal patterns in complex datasets. Correlation analysis between cemA expression and physiological parameters can establish functional relationships. Researchers should transparently report all statistical methods, including software packages, versions, and parameters used .

What are the best practices for validating antibodies used in cemA research to ensure specificity and reproducibility?

Comprehensive antibody validation is essential for reliable cemA research. Researchers should verify specificity through Western blotting against recombinant cemA protein alongside negative controls (knockout/knockdown samples) and competition assays using purified antigen. Antibodies should be tested across multiple experimental conditions and sample preparations to ensure consistent performance. Cross-reactivity with related proteins should be evaluated through immunoprecipitation followed by mass spectrometry. For immunolocalization studies, researchers should compare results from multiple antibodies targeting different cemA epitopes and include appropriate controls for each experiment. All validation data should be thoroughly documented and reported, including antibody source, catalog number, lot number, dilutions, and detailed experimental conditions. For critical experiments, independent antibody production or epitope tagging approaches can provide additional validation. Commercial antibodies should be selected based on validation documentation and tested in-house before use in key experiments .

How might single-molecule techniques advance our understanding of cemA dynamics in the chloroplast membrane?

Single-molecule techniques offer unprecedented insights into cemA behavior at the molecular level. Single-molecule fluorescence resonance energy transfer (smFRET) can track conformational changes of individual cemA molecules during substrate binding or protein-protein interactions. Total internal reflection fluorescence (TIRF) microscopy allows visualization of cemA diffusion and clustering in reconstituted membrane systems. Atomic force microscopy (AFM) can map the topography of cemA in native-like membrane environments and measure interaction forces with binding partners. Single-molecule force spectroscopy using optical or magnetic tweezers can characterize mechanical properties and unfolding pathways of cemA. These approaches require careful sample preparation, including site-specific labeling with fluorophores or attachment points. Researchers should develop appropriate reconstitution systems that mimic the native chloroplast membrane environment. Data analysis requires specialized software to track individual molecules and extract quantitative parameters from noisy signals .

What potential applications exist for engineered cemA variants in improving cucumber crop resilience?

Engineered cemA variants present promising opportunities for cucumber crop improvement. Researchers can design cemA modifications targeting enhanced CO₂ uptake efficiency, improved stress tolerance, or optimized function under fluctuating environmental conditions. Structure-guided mutagenesis targeting key functional domains can create cemA variants with altered activity or regulation. For practical implementation, site-directed chloroplast transformation using biolistic methods or novel delivery systems can introduce engineered cemA variants into cucumber chloroplasts. Phenotypic evaluation should include comprehensive physiological measurements under both optimal and stress conditions, focusing on photosynthetic efficiency, growth parameters, and yield components. Field trials under various environmental conditions are ultimately necessary to validate greenhouse observations. Potential unintended consequences should be carefully monitored, including effects on plant development, metabolic profiles, and interactions with beneficial microorganisms .

How can multi-omics approaches be integrated to build comprehensive models of cemA function in Cucumis sativus?

Integrated multi-omics approaches provide a systems-level understanding of cemA function. Transcriptomics (RNA-seq) can identify genes co-regulated with cemA or affected by cemA perturbation. Proteomics approaches, particularly quantitative methods (iTRAQ, TMT, SILAC), can track changes in the chloroplast proteome in response to cemA modification. Metabolomics using LC-MS/MS or GC-MS reveals metabolic consequences of altered cemA function. Lipidomics is particularly relevant for understanding how cemA affects chloroplast membrane composition. Integration of these datasets requires sophisticated computational approaches including network analysis, pathway enrichment, and machine learning algorithms to identify meaningful patterns and relationships. Researchers should employ statistical methods specifically designed for multi-omics integration, such as multi-block partial least squares or similarity network fusion. Visualization tools like Cytoscape or specialized multi-omics platforms help communicate complex relationships. Validation experiments should target key nodes identified through computational integration .

What role might cemA play in cucumber responses to combined biotic and abiotic stresses?

Investigation of cemA in combined stress scenarios requires carefully designed experiments that mimic real-world conditions. Researchers should apply controlled combinations of relevant abiotic stressors (drought, temperature extremes, salinity) with biotic challenges (pathogens, herbivores) in factorial experimental designs. Physiological measurements should track photosynthetic parameters, reactive oxygen species levels, and stress hormone production. Molecular analyses including transcript profiling, protein accumulation, and post-translational modification patterns of cemA under combined stresses may reveal stress-specific regulatory mechanisms. Comparative studies across cucumber varieties with different stress tolerance profiles can identify genotype-specific cemA responses. Researchers should employ mathematical modeling approaches such as response surface methodology to characterize complex interactions between stressors and their effects on cemA function and plant performance. Field studies under natural stress combinations provide ecological relevance to controlled environment findings .

How does understanding cemA function contribute to broader knowledge of chloroplast biology across plant species?

Research on Cucumis sativus cemA contributes significantly to our understanding of fundamental chloroplast processes across plant species. Comparative analyses of cemA structure, function, and regulation between cucumber and model plants (Arabidopsis, tobacco) can reveal conserved mechanisms of chloroplast envelope function and species-specific adaptations. By elucidating cemA's role in CO₂ uptake and ion transport, researchers gain insights into how different plant species optimize photosynthetic efficiency under varying environmental conditions. The study of cemA also enhances our understanding of chloroplast genome evolution and the coordination between nuclear and chloroplast genomes in regulating photosynthesis. Methodologies developed for cemA research in cucumber can be applied to other crop species, potentially leading to broader agricultural improvements. Researchers should place their cucumber cemA findings in the context of evolutionary conservation and divergence across the plant kingdom to maximize the impact of their work .

What ethical considerations should guide research on genetically modified cemA in Cucumis sativus?

Ethical considerations for genetically modified cemA research encompass scientific, environmental, and societal dimensions. Researchers must adhere to scientific integrity principles, including rigorous experimental design, transparent reporting of methodologies and results, and appropriate statistical analysis. Environmental considerations include containment measures for genetically modified plants, ecological risk assessments for potential gene flow, and long-term monitoring plans for field trials. Societal aspects involve stakeholder engagement, including farmers, consumers, and regulatory bodies, with clear communication about potential benefits, limitations, and uncertainties of the research. Intellectual property frameworks should balance innovation incentives with equitable access to technology, particularly for developing regions. Researchers should document comprehensive risk assessment focusing on both intended modifications and potential off-target effects. International collaborative research requires harmonization of regulatory approaches across different jurisdictions. Early integration of these ethical considerations into research planning strengthens both the scientific quality and societal value of cemA research .

How can researchers effectively communicate complex findings about cemA to diverse stakeholders?

Effective communication of cemA research requires tailored approaches for different audiences. For the scientific community, researchers should publish in peer-reviewed journals with comprehensive methodological details and data availability, present at relevant conferences, and participate in research networks. For agricultural stakeholders and breeders, practical implications should be emphasized through field days, extension bulletins, and workshop demonstrations that connect molecular findings to observable plant traits. For policymakers and regulators, evidence summaries with clear risk-benefit assessments and contextualization within existing regulatory frameworks are most effective. For the general public, accessible explanations focusing on real-world relevance, visual representations of complex concepts, and engagement through science communication platforms help build understanding and trust. All communications should acknowledge limitations and uncertainties in current knowledge while highlighting the value of basic research in addressing agricultural challenges. Researchers should develop communication skills through specialized training and collaboration with science communication professionals .

What funding strategies and collaborative approaches can accelerate cemA research in Cucumis sativus?

Accelerating cemA research requires strategic funding approaches and collaborative frameworks. Researchers should pursue diverse funding sources including government agencies focused on basic science and agricultural innovation, industry partnerships with seed companies or agribiotechnology firms, and agricultural foundations interested in crop improvement. Interdisciplinary grant proposals that connect molecular mechanisms to field-level outcomes are particularly compelling. International collaborations can leverage complementary expertise and resources, especially connecting teams with molecular biology strengths to those with cucumber breeding programs and field testing capabilities. Collaborative approaches should include material sharing agreements, standardized protocols to ensure comparable results across laboratories, and data sharing platforms to maximize research impact. Open science practices, including preprint sharing and open access publishing, accelerate knowledge dissemination. Early career researcher involvement through targeted fellowship programs ensures workforce development for continued research progress. Strategic partnerships with cucumber grower associations can provide real-world validation of laboratory findings and accelerate practical applications .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.