Recombinant Cucumis sativus Cytochrome b6-f complex subunit 4 (petD)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us; we will prioritize its implementation.
If you require a specific tag type, please inform us; we will prioritize its implementation.
Synonyms
petD; CsCp073; Cytochrome b6-f complex subunit 4; 17 kDa polypeptide
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Cucumis sativus (Cucumber)
Target Names
petD
Target Protein Sequence
MGVTKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACNVGLAVLEPS
MIGEPADPFATPLEILPEWYFFPVFQILRTVPNKLLGVLLMVSVPAGLLTVPFLENVNKF
QNPFRRPVATTVFLIGTAVALWLGIGATLPIDKSLTLGLF
Uniprot No.
Target Background
Function
A component of the cytochrome b6-f complex. This complex facilitates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Database Links
KEGG: csv:3429267
Protein Families
Cytochrome b family, PetD subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
