Recombinant Cucumis sativus Cytochrome b6 (petB)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant expression systems vary across commercial products:

ParameterDetailsSource
Expression SystemE. coli or cell-free systems
Tag TypeHis-tag (N-terminal) or undetermined during production
Purity>90% (SDS-PAGE confirmed)
Storage BufferTris-based buffer with 50% glycerol or PBS with trehalose
StabilityStore at -20°C/-80°C; avoid repeated freeze-thaw cycles

Photosynthesis Studies

The protein is used to:

  • Investigate electron transfer mechanisms in the cytochrome b6-f complex.

  • Study redox interactions between photosystems II and I .

Genetic and Disease Resistance Research

While not directly linked to petB, studies on cucumber (C. sativus) highlight:

  • Powdery Mildew (PM) Resistance: QTL mapping identified loci (pm5.1, pm6.1) associated with resistance, though petB itself is not a candidate gene .

  • Disease-Associated Proteins: Antibodies targeting cytochrome b6-f complex subunits (e.g., PetD) are used in Western blotting to study protein interactions in plant defense .

Challenges in Production

  • Tag Optimization: His-tags enhance solubility but may alter protein function in some applications .

  • Species-Specific Variations: C. sativus petB differs from cyanobacterial or algal orthologs in membrane integration and cofactor binding .

Future Directions

  • Disease Resistance: While petB itself is not linked to pathogen resistance, its role in redox signaling could intersect with stress-response pathways .

  • Biotechnological Applications: Engineered variants may improve photosynthetic efficiency in transgenic crops or biofuel production systems.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petB; CsCp072; Cytochrome b6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-215
Protein Length
full length protein
Species
Cucumis sativus (Cucumber)
Target Names
petB
Target Protein Sequence
MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT GVVLAVLTASFGVTGYSLPRDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL
Uniprot No.

Target Background

Function
Recombinant *Cucumis sativus* Cytochrome b6 (petB) is a component of the cytochrome b6-f complex. This complex mediates electron transfer between Photosystem II (PSII) and Photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Database Links

KEGG: csv:3429266

Protein Families
Cytochrome b family, PetB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the role of cytochrome b6 in cucumber photosynthesis?

Cytochrome b6, encoded by the petB gene, is a critical component of the cytochrome b6f complex (Cyt b6f) that plays pivotal roles in both linear and cyclic electron transport during oxygenic photosynthesis in cucumber plants. This protein complex serves as an essential intermediate electron carrier between photosystem II and photosystem I, facilitating proton transport across the thylakoid membrane and contributing to ATP synthesis . Unlike its counterparts in non-photosynthetic organisms, the cytochrome b6f complex in cucumber contains four large subunits that organize the electron transfer chain, similar to those found in other photosynthetic organisms including cyanobacteria .

How does the structure of cucumber cytochrome b6 compare to that in other plant species?

Cucumber (Cucumis sativus L.) cytochrome b6 shares high sequence homology with cytochrome b6 proteins from other plant species, maintaining the conserved functional domains necessary for electron transport. The protein contains multiple transmembrane helices that anchor it within the thylakoid membrane and specific binding sites for prosthetic groups including heme groups that facilitate electron transfer. While the core structure is conserved across plant species, cucumber-specific variations may exist in non-catalytic regions that could affect protein-protein interactions or regulatory mechanisms within the cytochrome b6f complex. These differences can be identified through comparative genomic analysis of the extensive genetic resources available in the USDA cucumber collection, which represents at least 96% of the genetic variation present in cucumber germplasm .

What genomic resources are available for studying cucumber cytochrome b6?

The United States National Plant Germplasm System (NPGS) maintains a comprehensive collection of cucumber germplasm that includes 1,234 accessions characterized by genotyping-by-sequencing (GBS) technology. This collection has generated over 23,000 high-quality single-nucleotide polymorphisms (SNPs) distributed throughout the cucumber genome, including those in and around the petB gene region . Researchers can access this valuable genetic resource to study natural variation in the cytochrome b6 gene, which may correlate with differences in photosynthetic efficiency or stress tolerance. The collection includes cultivars, landraces, and varieties from diverse geographical origins, offering a rich source of genetic diversity for cytochrome b6 studies .

What expression systems are most effective for producing recombinant cucumber cytochrome b6?

Based on successful recombinant protein production in related systems, the yeast Pichia pastoris expression system offers significant advantages for expressing recombinant cucumber cytochrome b6. This eukaryotic expression system provides appropriate post-translational modifications and protein folding machinery necessary for functional membrane proteins . When designing expression vectors, researchers should include:

  • A strong inducible promoter (e.g., AOX1)

  • Appropriate signal peptide for secretion or membrane targeting

  • Purification tags (His-tag or FLAG-tag) positioned to avoid interference with protein function

  • Codon optimization for improved expression in the host organism

For proper insertion of heme groups, co-expression with cytochrome c maturation proteins may be necessary. Expression conditions typically require optimization of induction temperature (20-30°C), induction duration (24-72 hours), and media composition to maximize yield of functional protein .

What purification methods yield the highest purity and activity for recombinant cucumber cytochrome b6?

Multi-step purification protocols are essential for obtaining high-purity, functional recombinant cucumber cytochrome b6:

  • Initial extraction using mild detergents (0.5-1% dodecyl maltoside or digitonin) to solubilize membrane proteins while preserving structure and function

  • Affinity chromatography using immobilized metal affinity chromatography (IMAC) if a His-tag is incorporated

  • Ion exchange chromatography as an intermediate purification step

  • Size exclusion chromatography as a final polishing step to remove aggregates and obtain homogeneous protein preparations

It is crucial to maintain the cold chain (4°C) throughout purification and include stabilizing agents such as glycerol (10-20%) to prevent protein denaturation. Research indicates that different levels of purification significantly impact biological activity, as demonstrated in similar recombinant protein studies where cruder preparations resulted in reduced activity and potential sample distortion . The most highly purified preparations typically demonstrate 85-99% biological activity in functional assays, while crude supernatants may show distortion effects.

Purification StageTypical PurityExpected ActivityNotes
Crude supernatant<50%Partial activity with distortion effectsHigh salt and contaminants may interfere
After affinity purification70-80%Improved activityRemoval of major contaminants
After ion exchange85-90%High activityRemoval of charged contaminants
After size exclusion>95%Maximum activityHomogeneous preparation ideal for structural/functional studies

How can researchers verify the structural integrity of recombinant cucumber cytochrome b6?

Multiple complementary techniques should be employed to verify the structural integrity of recombinant cucumber cytochrome b6:

  • Spectroscopic analysis: UV-visible spectroscopy to confirm characteristic absorption peaks of properly folded cytochrome b6 with correctly incorporated heme groups

  • Mass spectrometry: To confirm the molecular weight and post-translational modifications of the recombinant protein

  • Circular dichroism (CD): To assess secondary structure content and compare with native protein standards

  • Functional assays: Electron transfer activity measurements using artificial electron donors and acceptors

  • Western blot analysis: Using antibodies specific to cucumber cytochrome b6 or epitope tags

Researchers should particularly monitor the absorption spectra in both oxidized and reduced states, as the α, β, and Soret bands provide distinctive signatures of properly folded cytochrome proteins. Mass spectrometry analysis, similar to approaches used for other recombinant proteins, can confirm the exact mass and detect any unexpected modifications or proteolytic degradation .

How does cytochrome b6 function change under different light conditions in cucumber?

Cytochrome b6 function in cucumber varies significantly under different light conditions, reflecting its central role in photosynthetic electron transport flexibility:

Under high light conditions:

  • Increased linear electron flow through the cytochrome b6f complex

  • Enhanced cyclic electron transport around photosystem I to dissipate excess excitation energy

  • Regulatory adjustments through post-translational modifications that modulate electron transfer rates

Under low light conditions:

  • Optimized efficiency of linear electron transport

  • Fine-tuned balance between photosystems I and II via state transitions

  • Altered interactions with small regulatory subunits

Research with cyanobacterial mutants demonstrates that the loss of small subunits like PetN destabilizes the cytochrome b6f complex, reducing its abundance to approximately 20-25% of wild-type levels and decreasing oxygen evolution activity to ~30% . This indicates that small subunits, while not directly involved in electron transfer, are crucial for maintaining the structural integrity of the complex under varying environmental conditions. Studies of state transitions reveal that cytochrome b6f is required for these adaptive responses, as demonstrated by abolished state transitions in petN mutants observed through 77K fluorescence spectra and room temperature fluorescence kinetics .

How can recombinant cucumber cytochrome b6 be used to study electron transport chain inhibitors?

Recombinant cucumber cytochrome b6 provides an excellent system for studying the effects of electron transport chain inhibitors:

  • In vitro assays with purified recombinant protein can measure direct inhibition of electron transfer activity by compounds such as 2,5-dibromo-3-methyl-6-isopropylbenzoquinone (DBMIB)

  • Structure-based studies to identify binding sites of inhibitors through co-crystallization or molecular docking

  • Mutation studies of recombinant proteins to identify resistance mechanisms

Research with cyanobacterial systems shows that cytochrome b6f inhibitors like DBMIB have reduced effectiveness when the complex is destabilized, as both linear and cyclic electron transfer become partially insensitive to these inhibitors in mutants with compromised cytochrome b6f integrity . This suggests that structural changes in the cytochrome b6f complex can significantly alter inhibitor binding and efficacy, with important implications for herbicide development and understanding of electron transport regulation.

What experimental designs best demonstrate the impact of cytochrome b6 modifications on cucumber growth?

Robust experimental designs to evaluate cytochrome b6 modifications on cucumber growth should include:

  • Completely Randomized Block Design (CRD) with multiple replications (minimum three) to account for environmental variations

  • Multiple growth parameters measured systematically:

    • Vine length

    • Number of leaves

    • Leaf area

    • Chlorophyll content

    • Photosynthetic rate

    • Fruit yield parameters (number, length, weight)

Growth conditions should be standardized with plants spaced appropriately (e.g., 100 cm × 50 cm spacing has been shown to produce optimal cucumber growth parameters in field trials) . Data collection should occur at regular intervals from seedling stage through maturity, with statistical analysis using ANOVA at 5% level of significance to determine significant differences among treatments .

ParameterWild TypeCytochrome b6 ModifiedStatistical Significance
Vine length (cm)200 ± 15Varies by modificationp < 0.05
Leaf area (cm²)125 ± 10Varies by modificationp < 0.05
Chlorophyll content (mg/g)2.5 ± 0.2Varies by modificationp < 0.05
Net photosynthetic rate (μmol CO₂/m²/s)18 ± 2Varies by modificationp < 0.05
Fruit yield (kg/plant)3.8 ± 0.4Varies by modificationp < 0.05

How can researchers address expression and solubility challenges with recombinant cucumber cytochrome b6?

Cytochrome b6 is a membrane protein with hydrophobic domains that often present expression and solubility challenges. Researchers can implement these strategies to overcome common issues:

  • For poor expression:

    • Optimize codon usage for the expression host

    • Try different promoter strengths and induction conditions

    • Test expression with and without fusion tags

    • Consider using specialized strains designed for membrane protein expression

  • For low solubility:

    • Screen multiple detergents systematically (maltoside series, digitonin, Brij-35)

    • Test different detergent concentrations (typically 0.5-2%)

    • Include stabilizing agents like glycerol (10-20%) and specific lipids

    • Consider nanodiscs or amphipols for maintaining native-like membrane environments

  • For improper folding:

    • Co-express with chaperones specific to membrane proteins

    • Include heme precursors in growth media

    • Reduce expression temperature (16-20°C) to slow folding process

    • Consider refolding from inclusion bodies using specialized protocols

When working with detergent-solubilized proteins, researchers should monitor protein stability over time and avoid freeze-thaw cycles that can lead to aggregation and loss of activity.

What are the most effective methods for assessing electron transport activity of recombinant cucumber cytochrome b6?

To effectively measure electron transport activity of recombinant cucumber cytochrome b6:

  • Spectrophotometric assays:

    • Monitor absorbance changes at specific wavelengths (e.g., 563 nm for b-type cytochromes)

    • Use artificial electron donors like ascorbate/TMPD and acceptors like ferricyanide

    • Calculate electron transport rates from initial reaction velocities

  • Oxygen electrode measurements:

    • Integrate recombinant protein into liposomes or nanodiscs

    • Measure oxygen consumption or evolution depending on the specific electron transport pathway

    • Compare rates with and without specific inhibitors to confirm specificity

  • Fluorescence-based assays:

    • Monitor redox state changes using fluorescent probes

    • Perform 77K fluorescence spectroscopy to assess energy distribution between photosystems

Research in cyanobacterial systems demonstrates that electron transport activity can be assessed by measuring oxygen evolution, with wild-type systems showing full activity and compromised cytochrome b6f complexes showing reduced activity (approximately 30% of wild-type) . The use of electron carriers like N,N,N',N'-tetramethyl-p-phenylenediamine (TMPD) can bypass cytochrome b6f, providing a useful control to verify where in the electron transport chain activity is affected .

How can researchers distinguish between protein-specific effects and experimental artifacts when studying recombinant cucumber cytochrome b6?

To distinguish between protein-specific effects and experimental artifacts:

  • Include multiple controls:

    • Wild-type protein preparations

    • Inactive mutant versions (site-directed mutagenesis of key residues)

    • Mock preparations from expression systems without the target gene

    • Heat-denatured protein controls

  • Validate with complementary techniques:

    • Use both in vitro (purified protein) and in vivo (transformed plants/cells) systems

    • Apply different detection methods to confirm the same phenomenon

    • Perform dose-response studies to establish causality

  • Employ analytical quality controls:

    • Monitor protein purity through multiple purification steps

    • Assess protein stability throughout the experimental timeframe

    • Validate activity before and after storage conditions

Research with recombinant proteins shows that crude preparations can cause experimental artifacts, as seen in studies where crude extracts caused oocyte distortion while purified preparations showed specific biological activity . To minimize artifacts, researchers should aim for the highest level of protein purification, as highly purified preparations show maximum activity with minimal non-specific effects .

How does the quaternary structure of cytochrome b6f complex influence electron transport efficiency in stress-tolerant cucumber varieties?

The quaternary structure of cytochrome b6f complex significantly impacts electron transport efficiency, particularly under stress conditions. In cucumber, this complex consists of four large subunits (cytochrome b6, cytochrome f, subunit IV, and the Rieske iron-sulfur protein) and four small subunits unique to oxygenic photosynthesis . Research with cyanobacterial systems demonstrates that small subunits like PetN are crucial for complex stability, as their loss reduces complex abundance to 20-25% of wild-type levels .

Stress-tolerant cucumber varieties may exhibit:

  • Enhanced structural stability of the cytochrome b6f complex under temperature extremes

  • Modified interactions between the large and small subunits that maintain optimal electron transport under drought conditions

  • Altered association with lipid components that preserve membrane integrity during stress

The plastoquinone pool redox state, which becomes highly reduced when cytochrome b6f is compromised (as seen in PetN mutants), serves as a key regulatory signal for photosynthetic adaptations . Stress-tolerant cucumber varieties may maintain more balanced redox states through structural modifications to the cytochrome b6f complex that preserve electron flow under adverse conditions.

What role does cytochrome b6 play in cyclic electron flow regulation during cucumber fruit development?

Cytochrome b6 plays a central role in cyclic electron flow (CEF) regulation, which becomes particularly important during cucumber fruit development when energy demands shift:

  • Early fruit development stage:

    • Enhanced CEF generates additional ATP without NADPH production

    • Increased proton gradient supports transport processes needed for rapid cell division

    • Regulatory proteins interact with cytochrome b6f to modulate CEF rates

  • Middle to late fruit development:

    • Balanced linear and cyclic electron flow supports both energy production and carbon fixation

    • Dynamic adjustments to electron transport pathways accommodate changing metabolic needs

  • Ripening stage:

    • Altered CEF patterns support metabolic transitions from growth to ripening processes

    • Changed interactions between photosystem I and cytochrome b6f complex

Research with cyanobacterial systems shows that cytochrome b6f is essential for both linear and cyclic electron transport, as demonstrated by the impacts of complex destabilization on both pathways . During cucumber fruit development, the regulation of these pathways likely involves both structural changes to the complex and altered interactions with partner proteins.

Advanced techniques such as in vivo spectroscopy and isotope labeling can track electron flow patterns during different developmental stages, revealing how cytochrome b6 function adapts to meet the changing energetic and metabolic demands of developing cucumber fruits.

How can genomic variations in cucumber cytochrome b6 be correlated with photosynthetic efficiency across diverse environmental conditions?

Utilizing the extensive genetic resources available in cucumber collections, researchers can correlate cytochrome b6 genomic variations with photosynthetic performance through these approaches:

  • Genome-wide association studies (GWAS):

    • Identify natural variants in petB and regulatory regions across diverse cucumber accessions

    • Correlate specific SNPs with photosynthetic parameters measured under different environmental conditions

    • The USDA cucumber collection with over 23,000 high-quality SNPs provides an excellent resource for such analyses

  • Functional genomics validation:

    • Create recombinant versions of variant cytochrome b6 proteins

    • Perform in vitro electron transport assays under varying pH, temperature, and light conditions

    • Develop transgenic cucumber lines expressing variant forms for in planta validation

  • Environmental simulation experiments:

    • Test photosynthetic performance of lines with different cytochrome b6 variants under:

      • Drought stress

      • Temperature extremes

      • Light intensity variations

      • CO₂ concentration gradients

  • Structure-function analysis:

    • Use homology modeling and molecular dynamics simulations to predict how specific amino acid substitutions affect protein dynamics

    • Correlate structural predictions with experimental measurements

Data integration approaches that combine genomic, biochemical, physiological, and environmental datasets can reveal how specific variations in cucumber cytochrome b6 contribute to photosynthetic efficiency across diverse growing conditions. This systems biology approach could identify optimal cytochrome b6 variants for targeted breeding programs aimed at improving cucumber adaptation to climate change challenges.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.