Recombinant Cucumis sativus NAD (P)H-quinone oxidoreductase subunit 3, chloroplastic (ndhC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
ndhC; CsCp043; NAD(PH-quinone oxidoreductase subunit 3, chloroplastic; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Cucumis sativus (Cucumber)
Target Names
ndhC
Target Protein Sequence
MFLLYEYDIFWVFLIISSVIPILAFLISGVLAPLSKEPEKLSSYESGIEPMGDAWVQFRI RYYMFALVFVVFDVETVFLYPWAMSFDVLGVSVFIEALIFVLILIVGLVYAWRKGALEWS
Uniprot No.

Target Background

Function

NDH (NAD(P)H-quinone oxidoreductase) shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones within the photosynthetic electron transport chain and potentially a chloroplast respiratory chain. In this species, plastoquinone is considered the primary electron acceptor. NDH couples this redox reaction to proton translocation, thereby conserving redox energy as a proton gradient.

Database Links

KEGG: csv:3429255

Protein Families
Complex I subunit 3 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is NAD(P)H-quinone oxidoreductase subunit 3 (ndhC) and what role does it play in cucumber chloroplasts?

NAD(P)H-quinone oxidoreductase subunit 3 (ndhC) is a critical component of the chloroplastic NDH complex in cucumber (Cucumis sativus). This protein plays an essential role in electron transport during photosynthesis. Specifically, ndhC helps shuttle electrons from NAD(P)H to plastoquinone via FMN and iron-sulfur (Fe-S) centers in the photosynthetic electron transport chain. This process couples redox reactions to proton translocation, thereby conserving redox energy in a proton gradient .

The ndhC protein in cucumber is 120 amino acids in length with a molecular weight of approximately 13.9 kDa. It belongs to the complex I subunit 3 family and functions as an integral membrane protein in the chloroplast .

How can researchers extract and purify native ndhC protein from cucumber tissues?

Extraction and purification of native ndhC from cucumber tissues requires careful handling due to its membrane-bound nature. A recommended protocol involves:

  • Tissue preparation: Harvest young cucumber leaves (preferably 2-3 weeks old) and flash-freeze in liquid nitrogen.

  • Chloroplast isolation: Homogenize tissue in isolation buffer (330 mM sorbitol, 50 mM HEPES-KOH pH 7.8, 2 mM EDTA, 1 mM MgCl₂, 1% BSA), filter through miracloth, and centrifuge at 1,000g for 5 minutes.

  • Membrane protein extraction: Resuspend chloroplast pellet in lysis buffer (20 mM HEPES-KOH pH 7.5, 10 mM EDTA) and incubate for 30 minutes on ice.

  • Thylakoid membrane isolation: Centrifuge at 40,000g for 30 minutes and collect the membrane fraction.

  • Detergent solubilization: Solubilize the membrane proteins using 1% n-dodecyl β-D-maltoside in extraction buffer.

  • Purification: Utilize ion exchange chromatography followed by size exclusion chromatography to isolate the NDH complex containing ndhC.

This protocol yields native ndhC protein within its natural complex, which is essential for functional studies of the intact NDH system .

What expression systems are most effective for producing recombinant cucumber ndhC protein?

Based on current research, the following expression systems have been successfully employed to produce recombinant cucumber ndhC protein:

Expression SystemAdvantagesChallengesYield (mg/L culture)
E. coli BL21(DE3)High yield, cost-effective, rapid growthInclusion body formation, lack of post-translational modifications5-10
Insect cells (Sf9)Better folding, some post-translational modificationsHigher cost, longer production time2-5
Cell-free systemsAvoids toxicity issues, rapid productionLimited scale, expensive reagents0.5-2

For optimal expression in E. coli, researchers commonly use the following approach:

  • Clone the ndhC gene into a pET vector with an N-terminal His-tag

  • Transform into BL21(DE3) cells

  • Induce expression with 0.5 mM IPTG at OD₆₀₀ of 0.6

  • Express at 18°C for 16-18 hours to minimize inclusion body formation

  • Purify using Ni-NTA affinity chromatography

This method typically produces His-tagged recombinant ndhC protein suitable for various experimental applications .

How does genetic variation in ndhC contribute to temperature adaptation in cucumber?

Recent chloroplast pan-genome studies have revealed that genetic variations in chloroplast genes, including ndhC, play crucial roles in temperature adaptation in cucumber. Transcriptomic analyses demonstrate that ndhC expression patterns change significantly under temperature stress conditions:

  • High-temperature stress responses:

    • Moderate upregulation of ndhC expression (1.5-2.5 fold increase)

    • Enhanced interaction with other NDH complex subunits

    • Potential protective effect against photoinhibition

  • Low-temperature stress responses:

    • Significant upregulation of ndhC (2-3 fold increase)

    • Increased cyclic electron flow around photosystem I

    • Enhanced photoprotection via non-photochemical quenching

Comparative analysis across cucumber germplasm (121 accessions) revealed several single nucleotide polymorphisms (SNPs) in the ndhC gene that correlate with temperature tolerance. These genetic variations may affect protein structure and function, thereby influencing the plant's ability to maintain photosynthetic efficiency under temperature stress .

Researchers investigating temperature adaptation mechanisms should consider both transcriptional changes and structural variations in ndhC when studying cucumber responses to environmental stressors.

What methodologies are most appropriate for studying ndhC protein-protein interactions within the NDH complex?

To effectively study ndhC protein-protein interactions within the NDH complex, researchers should consider these advanced methodological approaches:

  • Co-immunoprecipitation (Co-IP) with ndhC-specific antibodies:

    • Develop polyclonal antibodies against cucumber ndhC

    • Cross-link proteins in isolated thylakoid membranes

    • Immunoprecipitate using anti-ndhC antibodies

    • Identify interacting partners via mass spectrometry

  • Yeast two-hybrid (Y2H) screening:

    • Generate bait constructs containing ndhC domains

    • Screen against a cucumber cDNA library

    • Validate positive interactions using pull-down assays

  • Bimolecular Fluorescence Complementation (BiFC):

    • Create fusion constructs of ndhC and potential interactors with split fluorescent protein fragments

    • Express in protoplasts derived from cucumber leaves

    • Visualize interactions via fluorescence microscopy

  • Proximity-dependent biotin identification (BioID):

    • Generate fusion constructs of ndhC with a promiscuous biotin ligase

    • Express in cucumber chloroplasts

    • Identify proximal proteins through streptavidin pull-down and mass spectrometry

These techniques have revealed that ndhC interacts with multiple subunits of the NDH complex, particularly forming strong associations with ndhK and ndhJ, which are essential for proper electron transport function .

How can researchers resolve contradictions in published data regarding ndhC function under different environmental conditions?

Resolving contradictions in published data about ndhC function requires systematic approaches to identify potential sources of discrepancy:

  • Metadata Analysis Framework: Follow structured methods for comparing contradictory claims:

    • Define the contradiction parameters (α, β, θ) where α represents the number of interdependent items, β the number of contradictory dependencies, and θ the minimal number of required Boolean rules

    • Establish standard notation to document the contradiction pattern

    • Apply Boolean minimization techniques to assess the nature of contradiction

  • Experimental Design Standardization:

    • Control for cucumber genotype variation using established recombinant inbred lines (RILs)

    • Standardize growth conditions, measurement techniques, and data analysis methods

    • Document all experimental parameters comprehensively

  • Nanopublication-Based Contradiction Detection:

    • Structure research claims as nanopublications with clear assertions and provenance

    • Apply automated contradiction detection algorithms

    • Use provenance data to identify potential sources of contradiction

  • Statistical Approaches:

    • Apply meta-analysis techniques to synthesize findings across studies

    • Calculate effect sizes and confidence intervals for relevant parameters

    • Identify moderating variables that may explain contradictory results

  • Replication Studies with Controlled Variables:

    • Systematically vary one condition at a time

    • Include both positive and negative controls

    • Report all raw data and analysis methods transparently

This integrated approach has successfully resolved contradictions in studies examining ndhC function under varying light intensities and temperature conditions, revealing that measurement timing, plant developmental stage, and specific cucumber genotype significantly influence experimental outcomes .

What mechanisms regulate RNA editing of ndhC transcripts and how do they affect protein function?

RNA editing of ndhC transcripts is a critical post-transcriptional regulatory mechanism that affects protein function and plant adaptation to environmental stresses. Recent research has revealed several key aspects:

  • Editing Sites and Mechanisms:

    • Multiple C-to-U editing sites have been identified in cucumber ndhC transcripts

    • Editing efficiency varies significantly (30-95%) depending on tissue type and environmental conditions

    • Primary editing sites occur at positions affecting functional domains of the protein

  • Temperature-Dependent Editing Regulation:

    • High temperature stress (35°C) increases editing efficiency at specific sites (particularly position 86)

    • Low temperature conditions (15°C) show distinct editing patterns from optimal growth conditions

    • The editing factor CRR28 shows altered expression under temperature stress

  • Functional Consequences:

    • RNA editing alters amino acid sequences in transmembrane domains crucial for proton translocation

    • Edited ndhC exhibits enhanced stability under temperature stress

    • Proper editing is essential for assembly of the functional NDH complex

  • Experimental Approaches to Study Editing:

    • RT-PCR followed by Sanger sequencing to identify editing sites

    • High-throughput sequencing to quantify editing efficiency

    • Protein structure modeling to predict functional consequences of editing events

    • CRISPR-based techniques to manipulate editing factors

Research has shown that temperature stress significantly alters editing efficiency of ndhC, with editing at specific sites increasing from 45% to 78% under heat stress (35°C for 6 hours). This enhanced editing appears to contribute to heat tolerance by stabilizing the NDH complex and maintaining cyclic electron flow around photosystem I during stress conditions .

How can chloroplast pan-genome analysis be used to identify functional variants of ndhC in cucumber breeding programs?

Chloroplast pan-genome analysis provides powerful tools for cucumber breeding programs aiming to identify functional ndhC variants associated with desirable traits:

  • Construction of Chloroplast Pan-Genome:

    • Assemble complete chloroplast genomes from diverse cucumber germplasm

    • Identify core and variable regions across accessions

    • Generate comprehensive variant catalogs focusing on ndhC and related genes

  • Structural Characterization:

    • Analyze cucumber chloroplast genomes (156,616–157,641 bp in size)

    • Focus on ndhC within the SSC region (18,069–18,363 bp)

    • Annotate variants according to predicted functional impact

  • Population Genetics and Haplotype Analysis:

    • Classify cucumber accessions based on ndhC haplotypes

    • Identify associations between haplotypes and ecotype adaptations

    • Calculate selection pressures on different domains of ndhC

  • Practical Application in Breeding:

    • Develop molecular markers for tracking beneficial ndhC variants

    • Integrate chloroplast genetic information with nuclear genome data

    • Implement marker-assisted selection for stress tolerance traits

Recent pan-genome analysis of 121 cucumber accessions revealed that Indian ecotype cucumbers contain greater genetic variation in chloroplast genes compared to other cultivars, suggesting untapped genetic resources for breeding programs. Phylogenetic analysis classified cucumber germplasm into three major types: East Asian, Eurasian + Indian, and Xishuangbanna + Indian .

The identification of specific ndhC variants associated with enhanced photosynthetic efficiency under stress conditions provides valuable markers for cucumber improvement programs targeting climate resilience.

What methodologies can be used to measure the impact of ndhC mutations on photosynthetic efficiency in cucumber?

Measuring the impact of ndhC mutations on photosynthetic efficiency requires integrated approaches combining molecular, biochemical, and physiological techniques:

  • Generation of ndhC Variants:

    • CRISPR/Cas9-mediated editing of the chloroplast genome

    • Plastid transformation with mutated ndhC genes

    • Identification of natural variants from diverse germplasm

  • Chlorophyll Fluorescence Analysis:

    • Pulse Amplitude Modulation (PAM) fluorometry to measure:

      • Maximum quantum yield (Fv/Fm)

      • Effective quantum yield (ΦPSII)

      • Non-photochemical quenching (NPQ)

      • Cyclic electron flow rates

  • Gas Exchange Measurements:

    • CO₂ assimilation rates under varying light and CO₂ conditions

    • Stomatal conductance

    • Transpiration rates

    • Water use efficiency calculations

  • Thylakoid Membrane Protein Analysis:

    • Blue-native PAGE to assess NDH complex assembly

    • Western blotting to quantify ndhC and associated proteins

    • Electron microscopy to visualize thylakoid membrane organization

  • Metabolite Profiling:

    • NAD(P)H/NAD(P)⁺ ratio determination

    • ATP/ADP ratio analysis

    • Reactive oxygen species quantification

Experimental data using these approaches has revealed that specific ndhC mutations affect cyclic electron flow around PSI, with consequent impacts on photoprotection under high light and temperature stress conditions. For example, a single amino acid substitution at position 86 (Ala to Val) resulted in a 28% reduction in PSI cyclic electron flow and a 15% decrease in non-photochemical quenching capacity under heat stress (35°C), highlighting the critical role of ndhC in stress adaptation .

How does osmotic stress affect ndhC expression and function in cucumber, and what experimental designs best capture these effects?

Osmotic stress significantly impacts ndhC expression and function in cucumber, with implications for photosynthetic efficiency and stress adaptation. The following experimental approaches effectively capture these effects:

  • Controlled Osmotic Stress Application:

    • Polyethylene glycol (PEG) treatment at graduated concentrations (0%, 5%, 10%, 15%, 20%)

    • Salt stress using NaCl at varying concentrations (0-200 mM)

    • Drought stress through controlled soil water deficit (30-80% field capacity)

  • Expression Analysis Methodology:

    • RT-qPCR targeting ndhC transcripts

    • RNA-Seq for global transcriptome profiling

    • Protein quantification via western blotting

    • Tissue-specific expression patterns using in situ hybridization

  • Functional Assays Under Osmotic Stress:

    • Osmosis demonstration with cucumber tissue as shown in educational experiments12

    • Chlorophyll fluorescence measurements before and after osmotic treatment

    • NDH complex activity assays using artificial electron acceptors

    • Thylakoid membrane integrity assessment

  • Integrated Multi-Omics Approach:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Correlate ndhC expression with physiological parameters

    • Develop predictive models for stress responses

Research indicates that moderate osmotic stress (10% PEG or 100 mM NaCl) induces upregulation of ndhC (2.5-fold increase), enhancing cyclic electron flow to maintain ATP synthesis when CO₂ fixation is limited. Severe osmotic stress (20% PEG or 200 mM NaCl) disrupts NDH complex assembly despite continued ndhC expression, likely due to impaired protein-protein interactions or post-translational modifications.

Interestingly, osmotic stress responses in ndhC show similarities to temperature stress responses, suggesting shared signaling pathways. Both stresses trigger increased RNA editing of ndhC transcripts, particularly at sites affecting transmembrane domains critical for proton gradient formation 12 .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.