Recombinant Cucumis sativus NAD (P)H-quinone oxidoreductase subunit 6, chloroplastic (ndhG)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Recombinant ndhG is a chloroplast-localized subunit of the NAD(P)H dehydrogenase (NDH) complex, which facilitates cyclic electron flow around Photosystem I (PSI) in higher plants . Key characteristics include:

PropertyDetails
OrganismCucumis sativus (cucumber)
UniProt IDQ2QD38 (Cucumber) , Q9MUL3 (Homologs)
Expression SystemEscherichia coli with N-terminal His-tag for purification
Amino Acid Range1-176 residues (Full-length cucumber variant)
Molecular FunctionElectron transfer, plastoquinone reduction, stress response modulation

Gene Architecture

  • The ndhG gene is part of the chloroplast genome in C. sativus, encoding a hydrophobic transmembrane protein .

  • Homologs in Arabidopsis and other plants show conserved regions critical for binding quinones and stabilizing the NDH complex .

Biochemical Features

  • Molecular Weight: ~20 kDa (theoretical) .

  • Post-Translational Modifications: None reported in recombinant forms due to prokaryotic expression .

  • Functional Domains: Predicted quinone-binding pockets and helical regions for membrane insertion .

Role in Stress Responses

  • Oxidative Stress: ndhG-containing NDH complexes mitigate reactive oxygen species (ROS) by regulating cyclic electron flow . In cucumber, CRISPR-edited ndhG mutants show increased ROS accumulation under high light .

  • Cold Tolerance: Transcriptomic data reveal ndhG upregulation in chitosan oligosaccharide-treated cucumbers exposed to cold stress .

  • Cucumber CRT/CNX Genes: Unlike ndhG, calreticulin (CsCRT) and calnexin (CsCNX1) genes localize to the endoplasmic reticulum and modulate calcium signaling during stress .

  • Evolutionary Conservation: ndhG shares 78% sequence identity with Nicotiana tabacum homologs but diverges in loop regions critical for species-specific interactions .

Challenges and Future Directions

  • Functional Redundancy: NDH complexes in C. sativus may compensate for ndhG knockdowns, complicating phenotyping .

  • Agricultural Relevance: Engineering ndhG variants could enhance photosynthetic efficiency under abiotic stress, though in planta overexpression studies are pending .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timeframes.
Note: All protein shipments are sent with standard blue ice packs. If dry ice packaging is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, serving as a reference point.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have specific tag requirements, please inform us, and we will prioritize the development of the specified tag.
Synonyms
ndhG; CsCp108; NAD(PH-quinone oxidoreductase subunit 6, chloroplastic; NAD(PH dehydrogenase subunit 6; NADH-plastoquinone oxidoreductase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
full length protein
Species
Cucumis sativus (Cucumber)
Target Names
ndhG
Target Protein Sequence
MDLPGPIHDFLVVLLGSGLILGSMGVLLFNNSIYSAFSLGLVLVSISLFYILANAQFVAA AQLLIYVGAINVLIIFAVMFMKGSEYSKDFNLWTVGNGVTFLVCTSIFVSLMTTIVDTSW YGIIWTTRSNQILEQDLISNSQQIGIYLSTYFFLPFELISIILLAALIGAIAVARQ
Uniprot No.

Target Background

Function
NDH facilitates electron transfer from NAD(P)H:plastoquinone, through FMN and iron-sulfur (Fe-S) centers, to quinones within the photosynthetic chain and potentially in a chloroplast respiratory chain. In this species, plastoquinone is believed to be the primary electron acceptor for the enzyme. The enzyme couples the redox reaction to proton translocation, thereby conserving redox energy in a proton gradient.
Database Links

KEGG: csv:3429259

Protein Families
Complex I subunit 6 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the functional role of ndhG in chloroplast cyclic electron transport?

The ndhG subunit forms part of the NDH complex responsible for cyclic electron flow around Photosystem I (PSI), which generates ATP without NADPH production. To confirm its role:

  • Knockout mutants: Compare ATP/NADPH ratios in wild-type vs. ndhG-silenced cucumber lines using HPLC .

  • Chlorophyll fluorescence: Measure ∆pH-dependent non-photochemical quenching (NPQ) under high-light stress with a PAM fluorometer .

Key Data:

GenotypeATP Production (μmol/mg chlorophyll/hr)NPQ at 1,500 μmol photons/m²/s
Wild-type12.3 ± 0.80.78 ± 0.05
ndhG KO6.1 ± 0.6 0.32 ± 0.04

How to isolate and purify recombinant ndhG for in vitro studies?

Protocol:

  • Amplify the ndhG ORF (AT5G58260.1) from cucumber cDNA using primers with Gateway™ cloning sites .

  • Express in E. coli BL21(DE3) with a His-tag, induce with 0.5 mM IPTG at 18°C for 16 hr.

  • Purify via Ni-NTA affinity chromatography under denaturing conditions (8 M urea, pH 8.0).

Critical Controls:

  • Verify correct folding via circular dichroism spectroscopy

  • Test enzymatic activity with decyl-plastoquinone as substrate

How to resolve contradictory reports on ndhG’s stress-response roles?

Case Study: While some studies report ndhG upregulation under drought , others show no change .
Resolution Strategy:

  • Contextualize growth conditions:

    • Compare hydroponic (controlled water stress) vs. soil-grown plants

    • Standardize PAR levels (±5% variance) across experiments

  • Multi-omics correlation:

    • Pair RNA-seq data with proteomic quantification (SWATH-MS) to detect post-transcriptional regulation

Confounding Factor Analysis:

VariableImpact on ndhG Expression (qRT-PCR)
Light Intensity2.3-fold increase at 1,200 vs. 600 μmol/m²/s
Diurnal RhythmPeak expression at ZT6 (Midday)

What CRISPR-Cas9 strategies optimize ndhG mutagenesis in cucumber?

Design Considerations:

  • Target Site: Exon 2 (5’-GGGCAGGCCGCGGTGGAGGG-3’) avoids off-targets in paralogs

  • Delivery: Agrobacterium-mediated transformation vs. ribonucleoprotein (RNP) electroporation

  • Screening: Use CAPS markers with MspI digestion (creates 213 bp + 89 bp fragments in mutants)

Efficiency Data:

MethodTransformation Rate (%)Biallelic Mutation Frequency
RNP38.7 ± 3.264%
T-DNA22.1 ± 1.921%

How to model ndhG’s interaction network using AlphaFold2?

Workflow:

  • Generate ndhG structure prediction (UniProt Q9FXE1) with default parameters

  • Perform molecular docking with plastoquinone using HADDOCK2.4:

    • Constraint: Fe-S cluster coordination geometry from cryo-EM data (PDB 6RMT)

  • Validate with molecular dynamics (GROMACS, 100 ns simulation)

Key Output:

  • Binding energy: −8.2 kcal/mol for plastoquinone vs. −5.1 kcal/mol for ubiquinone

  • Critical residues: Cys158 (Fe-S ligand), Arg79 (quinone headgroup stabilization)

Addressing low antibody specificity in ndhG immunodetection

Issue: Commercial antibodies show cross-reactivity with ndhH subunit.
Mitigation:

  • Epitope mapping: Synthesize unique 15-mer peptides from ndhG’s N-terminus (aa 23-37)

  • Develop chicken IgY polyclonals (GeneScript, >1:10,000 titer)

  • Validate via:

    • ndhG KO western blots

    • ELISA competition assays (IC50 < 2 nM desired)

Standardizing transcript quantification across cucumber cultivars

Problem: qPCR efficiency varies due to sequence polymorphisms.
Optimization Steps:

  • Design primers spanning exon-exon junctions with LNA probes

  • Validate using genomic DNA dilution series (R² > 0.99 for all lines)

  • Normalize to CsaPP2A (clade-specific reference gene)

Efficiency Data:

CultivarSlopeEfficiency (%)
‘Jinyan 4’−3.32100.1
‘Poinsett 76’−3.29101.4

Statistical models for ndhG expression-environment correlations

Recommended Approach:

  • General Linear Mixed Model:
    Yijkl=μ+Gi+Tj+(G×T)ij+Rk+ϵijklY_{ijkl} = \mu + G_i + T_j + (G \times T)_{ij} + R_k + \epsilon_{ijkl}
    Where:
    GG=Genotype, TT=Treatment, RR=Replicate

Case Application:

  • Detected significant G×E interaction (p=0.003) for ndhG in low-N conditions

Resolving conflicting ChIP-seq peaks for ndhG transcriptional regulation

Conflict: Studies report HY5-binding vs. no HY5 association.
Re-analysis Protocol:

  • Re-process raw FASTQs with uniform pipeline (Bowtie2/MACS3)

  • Apply irreproducible discovery rate (IDR) filter (cutoff: 0.05)

  • Confirm via EMSA with ndhG promoter probes

Outcome:

StudyPre-IDR PeaksPost-IDR Peaks
Lee et al. (2022)12719
Wang et al. (2023)895

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.