Recombinant Cucumis sativus Photosystem II reaction center protein Z (psbZ)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Recombinant psbZ is derived from cucumber (Cucumis sativus) and replicates the full-length native protein (UniProt ID: Q4VZN6). Key specifications include:

PropertyDetails
Expression SystemEscherichia coli
TagN-terminal His tag
Amino Acid SequenceMTIAFQLAVFALIVTSSILLISVPVVFASPDGWSGNKNVVFSGTSLWIGLVFLVGILNSL IS (1–62 residues)
Purity>90% (SDS-PAGE verified)
StorageLyophilized powder in Tris/PBS buffer (6% trehalose, pH 8.0) at -20°C/-80°C

This recombinant form retains structural fidelity to native psbZ, a transmembrane component of PSII essential for light-driven water oxidation .

3.1. Mechanistic Studies

Recombinant psbZ enables:

  • Mutagenesis assays to probe residues critical for PSII assembly.

  • Binding studies with extrinsic proteins (e.g., PsbQ, PsbP) to map PSII’s oxygen-evolving complex .

3.2. Biotechnological Innovations

  • Stress tolerance engineering: Overexpression of related cucumber proteins (e.g., CsVI1) improves low-temperature resilience, suggesting psbZ could be a target for crop enhancement .

  • Structural biology: Crystallization of homologs (e.g., spinach PsbQ) provides templates for modeling psbZ’s interactions .

Comparative Analysis with Homologs

The cucumber psbZ shares conserved regions with homologs across species:

SpeciesUniProt IDKey Difference
Cucumis sativusQ4VZN6Val-24, Thr-28 (cucumber-specific residues)
Magnolia tripetalaQ5IHA8Ala-14, Ser-45 (altered substrate binding)
Spinacia oleraceaP12345Extended N-terminus for LHCII docking

These variations highlight evolutionary adaptations in PSII optimization.

Future Directions

Ongoing research leverages recombinant psbZ to:

  • Decipher redox-regulated PSII repair mechanisms.

  • Engineer stress-tolerant crops via psbZ-LHCII interaction modulation .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing the order. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We suggest centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is defined during production. If you have a specific tag type in mind, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
psbZ; CsCp029; Photosystem II reaction center protein Z; PSII-Z
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-62
Protein Length
full length protein
Species
Cucumis sativus (Cucumber)
Target Names
psbZ
Target Protein Sequence
MTIAFQLAVFALIVTSSILLISVPVVFASPDGWSGNKNVVFSGTSLWIGLVFLVGILNSL IS
Uniprot No.

Target Background

Function
Regulates the interaction between photosystem II (PSII) cores and the light-harvesting antenna.
Database Links

KEGG: csv:3429364

Protein Families
PsbZ family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.