Recombinant Cucumis sativus Photosystem Q (B) protein (psbA)

Shipped with Ice Packs
In Stock

Description

Structure and Function of PsbA/D1 Protein

The D1 protein forms the reaction center of PSII, binding critical cofactors like plastoquinone, chlorophyll, and manganese clusters. Key features include:

  • Molecular weight: ~32 kDa

  • Membrane topology: Five transmembrane helices with stromal- and lumen-facing loops

  • Functional domains:

    • DE-loop (amino acids 234–242 in A. thaliana): Involved in plastoquinone Q<sub>B</sub> binding

    • Redox-active tyrosine residue (Tyr<sub>Z</sub>): Facilitates electron transfer to the oxygen-evolving complex

FeaturePsbA in PlantsPsbA in Cyanobacteria
Gene locationChloroplast genome Chloroplast genome
Post-translational regulationLight-dependent synthesis Light-regulated transcription
Key interacting partnersHCF173, LPE1 (translation factors) PsaL, PsaB (structural subunits)

Recombinant PsbA Production

Recombinant PsbA is typically expressed in E. coli systems for biochemical studies, as exemplified by the S. lycopersicum homolog :

  • Expression system: E. coli BL21(DE3) with N-terminal His-tag

  • Purification: Affinity chromatography under denaturing conditions

  • Sequence: Full-length mature protein (residues 2–344)

  • Purity: >90% (SDS-PAGE verified)

Critical parameters for functional reconstitution:

  • Chaperones: Rubredoxin 1 enhances proper folding in Chlamydomonas reinhardtii

  • Redox conditions: Light-dependent association of translational regulators (e.g., LPE1) with psbA mRNA

  • Post-translational modifications: Phosphorylation regulates turnover and repair cycles

Research Applications and Challenges

Recombinant PsbA enables:

  • Antibody development: Anti-PsbA antibodies target conserved regions (e.g., DE-loop) for immunoblotting

  • Structural studies: Cryo-EM and X-ray crystallography require homogeneous protein samples

  • Mutational analysis: Investigating herbicide resistance (e.g., atrazine-binding Q<sub>B</sub> site)

Limitations in current systems:

  • Misfolding: Heterologous expression often yields insoluble protein requiring refolding

  • Cofactor incorporation: Phylloquinone and Fe-S clusters require plant-specific assembly machinery absent in E. coli

Future Directions for Cucumis sativus PsbA

While no published studies specifically address C. sativus PsbA, prior work suggests:

  1. Comparative genomics: Align C. sativus psbA with homologs (e.g., tomato Q2MIC0 ) to identify species-specific motifs.

  2. Hybrid expression systems: Combine chloroplast-derived translation factors (e.g., HCF173 ) with E. coli expression to improve folding.

  3. High-throughput mutagenesis: Screen for variants with enhanced photostability using chlorophyll fluorescence assays .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. If you have a specific format preference, please indicate it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipment is required, please inform us in advance, as additional fees may apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is defined during production. If you have a specific tag type requirement, please inform us. We will prioritize developing the specified tag if feasible.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Cucumis sativus (Cucumber)
Target Names
psbA
Target Protein Sequence
MTAILERRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDI DGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFL LGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGF NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that utilizes light energy to extract electrons from H2O, generating O2 and a proton gradient subsequently used for ATP formation. It comprises a core antenna complex responsible for photon capture and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors.
Database Links

KEGG: csv:3429275

Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the function of the psbA gene in Cucumis sativus?

The psbA gene in Cucumis sativus (cucumber) encodes the D1 protein, also known as Photosystem Q(B) protein, which serves as a critical component of Photosystem II (PSII). This protein is essential for oxygenic photosynthetic electron transport and functions as a binding site for plastoquinone B . The D1 protein forms part of the reaction center of PSII and is involved in the initial steps of photosynthesis and electron transport .

The protein plays a crucial role in water oxidation and is highly dynamic under varying light conditions, requiring efficient synthesis and repair mechanisms . In cucumber, as in other plants, the D1 protein is particularly vulnerable to photodamage, necessitating a rapid turnover and replacement process to maintain photosynthetic efficiency.

How does psbA gene structure in cucumber compare to other plant species?

The psbA gene in cucumber is located in the chloroplast genome and, unlike some cyanobacteria that possess multiple copies of the psbA gene (e.g., psbA1, psbA2, psbA3), cucumber and most higher plants typically have a single copy . The gene structure includes introns and exons, with research showing that exon 4 contains important functional regions that can be targeted for mutagenesis .

Comparative analysis reveals that while the cucumber psbA gene shares significant sequence conservation with other plant species, there are specific variations that may contribute to differences in photosynthetic efficiency and stress responses. In cyanobacteria like Anacystis nidulans, three psbA genes encode D1 proteins with varying amino acid sequences (up to 25 residues difference out of 360), while each gene independently provides sufficient functional protein to support normal photosynthetic growth .

What data exists on the expression patterns of psbA in cucumber tissues?

Expression patterns of psbA in cucumber have been studied across different developmental stages and tissues. Quantitative real-time PCR analysis has been used to measure psbA gene expression levels in cucumber fruit tissues.

Research shows that psbA expression varies significantly between different tissues and developmental stages in cucumber. For example:

  • Expression is generally higher in photosynthetically active tissues

  • Differential expression occurs between mesocarp and endocarp tissues during fruit development

  • Light conditions significantly affect expression levels

Researchers typically use the CsActin gene as an internal control for normalization when quantifying psbA expression in cucumber tissues . Gene expression studies have demonstrated that environmental stressors like temperature fluctuations can impact psbA transcript levels, which has implications for understanding cucumber's response to adverse growing conditions .

What techniques are available for targeted mutagenesis of the psbA gene in cucumber?

Targeted mutagenesis of the psbA gene in cucumber can be achieved through several methodologies, with homologous recombination being particularly effective as demonstrated in research literature. An efficient protocol involves:

  • Design of a transforming DNA fragment containing:

    • The mutated form of the target exon (e.g., exon 4)

    • Flanking intron sequences to facilitate homologous recombination

    • Optional inactivation of restriction sites (e.g., HindIII) for screening purposes

  • Preparation of cucumber cells:

    • Treatment with 5-fluoro-2′-deoxyuridine (FUDR) to reduce chloroplast DNA copies

    • Optimization of growth conditions for transformation efficiency

  • Transformation methodology:

    • Biolistic transformation (particle bombardment)

    • Co-transformation with modified DNA fragment and antibiotic resistance marker

    • Recommended ratio of 5:2 (linear fragment to circular plasmid)

  • Selection and screening approach:

    • Initial selection on spectinomycin-containing media

    • PCR amplification of the plastomic psbA DNA fragment

    • Restriction analysis to identify successful transformants

    • Sequencing to confirm the desired mutations

This approach has been successfully used to target mutations to the psbA gene in cucumber chloroplasts, enabling the introduction of specific amino acid substitutions for functional studies of the D1 protein.

What methods are most effective for quantifying psbA protein expression levels in cucumber?

Multiple techniques are available for quantifying psbA protein (D1) expression levels in cucumber, each with specific advantages depending on research objectives:

  • Western blotting with D1-specific antibodies:

    • Allows semi-quantitative assessment of protein levels

    • Can detect post-translational modifications

    • Relatively straightforward but less precise for absolute quantification

  • Reverse phase-LC-electrospray mass ionization-MS/MS (RP-LC-ESI-MS/MS):

    • Enables precise protein quantification despite high sequence similarity between protein isoforms

    • Allows comparison of transcript and protein levels

    • Has been successfully used to quantify PsbA proteins in photosynthetic organisms

  • Pulse-chase experiments:

    • Assess protein turnover rates using radioactive labeling

    • Particularly valuable for studying D1 protein dynamics under stress conditions

    • Provides insights into synthesis and degradation rates

  • Immunoprecipitation techniques:

    • Allow isolation of protein complexes containing D1

    • Can be combined with mass spectrometry for quantification

    • Useful for studying protein-protein interactions

When designing protein expression studies, researchers should consider the developmental stage, tissue specificity, and environmental conditions (especially light intensity and quality) as these significantly impact D1 protein levels in cucumber.

How can researchers effectively use recombinant Cucumis sativus psbA protein for in vitro studies?

Effective use of recombinant Cucumis sativus psbA protein (D1) for in vitro studies requires careful attention to protein integrity and experimental conditions:

  • Protein handling recommendations:

    • Store at -20°C for routine use, or -80°C for extended storage

    • Avoid repeated freeze-thaw cycles

    • Maintain working aliquots at 4°C for up to one week

    • Use Tris-based buffer with 50% glycerol for stability

  • Functional assay optimization:

    • Temperature control: Critical for maintaining photosynthetic activity

    • Light conditions: Controlled illumination for photochemical studies

    • Redox environment: Maintaining physiologically relevant conditions

    • Detergent selection: Critical for membrane protein solubility

  • Experimental applications:

    • Electron transport studies using artificial electron acceptors/donors

    • Herbicide binding assays to study inhibitor interactions

    • Structural analyses through spectroscopic methods

    • Protein-protein interaction studies

  • Quality control measures:

    • Verification of protein integrity by SDS-PAGE before experiments

    • Activity assays to confirm functional status

    • Spectroscopic analysis to assess proper folding and cofactor incorporation

The recombinant protein sequence includes critical functional domains necessary for electron transport and herbicide binding, making it valuable for detailed mechanistic studies of photosynthetic processes when properly handled and characterized .

How do mutations in the psbA gene affect photosynthetic efficiency in cucumber?

Mutations in the cucumber psbA gene can significantly impact photosynthetic efficiency through alterations in electron transport and protein stability. Research has demonstrated that:

  • Specific amino acid substitutions can alter:

    • Electron transfer kinetics between QA and QB

    • Binding affinity for plastoquinone

    • Susceptibility to photodamage

    • Thermal stability of Photosystem II

  • Key functional impacts include:

    • Changes in the QB binding site affecting herbicide sensitivity and electron transport

    • Alterations in the redox properties of electron carriers

    • Modified charge recombination pathways

    • Shifts in the free energy between redox pairs

  • Experimental evidence shows that:

    • PsbA3 variants in cyanobacteria provide better protection against photoinhibition compared to PsbA1

    • This protection occurs through increased probability of harmless dissipation of excess energy

    • The redox potential of pheophytin shifts toward more positive values in certain variants

These findings suggest that strategic modifications to the psbA gene could potentially enhance photosynthetic performance under adverse environmental conditions, although attempts to introduce thermotolerance-enhancing mutations have shown mixed results. For example, introducing mutations previously shown to increase heat stability in cyanobacteria did not necessarily confer the same benefits in cucumber .

What role does the psbA gene play in cucumber responses to environmental stresses?

The psbA gene plays a central role in cucumber responses to environmental stresses, particularly through the regulation of D1 protein turnover and photosystem II repair:

Understanding these stress response mechanisms provides insights into cucumber adaptation strategies and potential targets for improving stress tolerance in agricultural settings.

How does the regulatory network controlling psbA expression in cucumber compare with other plant systems?

The regulatory network controlling psbA expression in cucumber involves complex interactions at multiple levels, with both conserved and species-specific features compared to other plant systems:

  • Transcriptional regulation:

    • Cucumber utilizes plastid-encoded RNA polymerase (PEP) for psbA transcription

    • Light-responsive elements in the promoter region show conservation across species

    • Species-specific transcription factors modulate expression under various conditions

  • Post-transcriptional regulation:

    • RNA-binding proteins regulate transcript processing and stability

    • Unlike cyanobacteria with multiple psbA genes, cucumber must regulate its single copy through post-transcriptional mechanisms

    • The LOW PHOTOSYNTHETIC EFFICIENCY 1 (LPE1) protein identified in Arabidopsis directly binds to the 5' UTR of psbA mRNA in a light-dependent manner through a redox-based mechanism

  • Translational regulation:

    • Light-dependent control of translation initiation is a key control point

    • In Arabidopsis, LPE1 interacts with HIGH CHLOROPHYLL FLUORESCENCE 173 (HCF173) and facilitates the association of HCF173 with psbA mRNA

    • Less efficient loading of ribosomes on psbA mRNA occurs in the absence of these regulatory factors

  • Integration with cellular signaling:

    • Chloroplast-to-nucleus retrograde signaling pathways coordinate nuclear and chloroplast gene expression

    • Redox signals from the photosynthetic electron transport chain influence psbA expression

    • Stress response pathways integrate with photosynthetic gene regulation

This complex regulatory network enables cucumber to maintain appropriate D1 protein levels under varying environmental conditions, though species-specific differences in regulatory factors and mechanisms exist compared to model plants like Arabidopsis.

What are the best approaches for designing experiments to study psbA gene function in cucumber?

Designing robust experiments to study psbA gene function in cucumber requires careful consideration of multiple factors:

  • Genetic manipulation strategies:

    • Targeted chloroplast transformation using biolistic methods

    • Homologous recombination-based approaches for introducing specific mutations

    • Creation of knockout or knock-down systems for associated regulatory factors

    • Comparison with natural variants from cucumber germplasm collections

  • Experimental controls:

    • Wild-type controls processed in parallel with experimental samples

    • Inclusion of known psbA variants with characterized phenotypes

    • Appropriate reference genes for expression studies (e.g., CsActin)

    • Dark-adapted vs. light-exposed samples for photosynthetic measurements

  • Environmental variables to consider:

    • Light conditions: intensity, duration, spectral quality

    • Temperature regimes: optimal vs. stress conditions

    • Developmental stages: seedling vs. mature plant responses

    • Tissue specificity: leaf vs. fruit photosynthetic tissues

  • Phenotypic assessment methods:

    • Chlorophyll fluorescence measurements (Fv/Fm, NPQ)

    • Oxygen evolution assays

    • Electron transport rate determination

    • Growth and development parameters

  • Molecular analysis approaches:

    • RT-qPCR for transcript quantification

    • Protein analysis using western blotting or mass spectrometry

    • DNA sequencing to confirm genetic modifications

    • Bioinformatic analysis of sequence variations

This comprehensive experimental design approach allows for robust assessment of psbA gene function in cucumber while accounting for potential confounding factors and ensuring reproducibility of results.

How can researchers effectively analyze psbA gene evolution and variation in cucumber germplasm?

Analyzing psbA gene evolution and variation in cucumber germplasm requires specialized approaches that incorporate both molecular techniques and bioinformatic analysis:

  • Germplasm sampling strategy:

    • Comprehensive representation of genetic diversity

    • Inclusion of wild relatives and landraces

    • Geographic representation from diverse regions

    • The US National Plant Germplasm System (NPGS) collection represents a valuable resource containing 1,234 cucumber accessions

  • Genotyping approaches:

    • High-throughput genotyping-by-sequencing (GBS) has successfully generated over 23,000 SNPs for cucumber analysis

    • Whole-genome resequencing of core collections

    • Targeted amplification and sequencing of the psbA region

    • PCR-RFLP for specific variant screening

  • Sequence analysis methods:

    • Multiple sequence alignment tools optimized for chloroplast genes

    • Phylogenetic analysis using maximum likelihood methods

    • Selection analysis to identify regions under evolutionary pressure

    • Haplotype network construction to visualize relationships

  • Data interpretation frameworks:

    • Population structure analysis to identify subpopulations

    • Linkage disequilibrium mapping for associated traits

    • Identification of selective sweeps during domestication

    • Geographic distribution patterns of specific variants

  • Practical applications:

    • Development of a core collection representing maximum genetic diversity

    • Identification of valuable haplotypes for breeding programs

    • Association of psbA variants with agronomic traits

    • Conservation priorities for unique genetic resources

This integrated approach has revealed that cucumber underwent a narrower genetic bottleneck during domestication than grain crops and identified specific genomic regions associated with domestication traits .

What statistical methods are most appropriate for analyzing psbA expression data in stress response studies?

  • Experimental design considerations:

    • Randomized complete block designs to control environmental variables

    • Factorial designs for multiple stress treatments

    • Time-course sampling for dynamic responses

    • Appropriate biological and technical replication (6-8 individuals recommended)

  • Data preprocessing steps:

    • Normalization to reference genes (CsActin commonly used)

    • Log transformation for non-normally distributed data

    • Removal of outliers based on established criteria

    • Quality control of RNA/protein samples

  • Statistical analysis approaches:

    • ANOVA with repeated measures for time-course studies

    • Two-way ANOVA for factorial designs with type of treatment and dose as factors

    • Linear regression analysis to describe relationships between variables

    • T-tests to compare differences between specific conditions

  • Post-hoc testing and validation:

    • Least significant difference (LSD) tests for pairwise comparisons

    • Tukey's HSD for multiple comparisons

    • False Discovery Rate (FDR) correction for multiple testing

    • Bootstrapping for confidence interval estimation

  • Data visualization methods:

    • Box plots showing distribution of expression values

    • Heat maps for multi-factor experiments

    • Line graphs for time-course studies

    • Bar charts with error bars for treatment comparisons

The specific statistical approach should be selected based on the experimental design, data structure, and research questions. For example, when studying environmental stress effects, a two-way ANOVA with repeated measures is often appropriate when examining both treatment type and dose effects over time .

How can knowledge of the psbA gene be applied to improving cucumber crop resilience?

Knowledge of the psbA gene offers several promising avenues for improving cucumber crop resilience through both conventional breeding and biotechnological approaches:

  • Germplasm exploration and utilization:

    • Screening diverse cucumber accessions for beneficial psbA variants

    • Utilizing the US National Plant Germplasm System's core collection of 395 accessions that represents 96% of the genetic variation present in the NPGS

    • Identifying haplotypes associated with stress tolerance and photosynthetic efficiency

  • Targeted breeding strategies:

    • Marker-assisted selection for favorable psbA variants

    • Development of high-throughput screening methods for photosynthetic efficiency

    • Integration with other traits for comprehensive crop improvement

  • Genetic engineering approaches:

    • Chloroplast transformation to introduce specific psbA mutations

    • Development of site-directed mutagenesis techniques for cucumber chloroplasts

    • Creation of D1 protein variants with enhanced stability under stress conditions

  • Stress tolerance enhancement:

    • Engineering variants with improved high light tolerance

    • Developing lines with enhanced thermal stability

    • Creating variants with reduced susceptibility to photoinhibition

  • Research directions with practical applications:

    • Understanding D1 turnover mechanisms under field conditions

    • Developing non-destructive phenotyping methods for photosynthetic efficiency

    • Exploring interactions between nuclear and chloroplast genomes in determining stress responses

By applying these approaches, researchers can work toward developing cucumber varieties with improved resilience to environmental stresses, contributing to sustainable agricultural production in the face of climate change challenges.

What are the future research directions for understanding psbA gene function in cucumber?

Future research on psbA gene function in cucumber is likely to expand in several promising directions:

  • Systems biology approaches:

    • Integration of transcriptomics, proteomics, and metabolomics data

    • Network analysis of photosynthetic gene regulation

    • Multi-omics studies of stress responses involving D1 protein

    • Modeling of D1 turnover dynamics under fluctuating environments

  • Advanced genetic engineering techniques:

    • CRISPR-based approaches for precise chloroplast genome editing

    • Development of inducible expression systems for D1 variants

    • Creation of synthetic D1 proteins with novel properties

    • Optimization of transformation protocols for routine chloroplast engineering

  • Structural and functional studies:

    • High-resolution structural analysis of cucumber D1 protein

    • Structure-guided design of improved D1 variants

    • Investigation of protein-protein interactions within PSII

    • Analysis of post-translational modifications affecting D1 function

  • Environmental adaptation mechanisms:

    • Field-based studies of D1 turnover under natural conditions

    • Climate change response modeling

    • Investigation of genotype-by-environment interactions

    • Adaptive evolution of psbA in wild cucumber populations

  • Translational research opportunities:

    • Development of biomarkers for stress tolerance selection

    • Creation of high-throughput screening platforms for photosynthetic efficiency

    • Integration with crop modeling for yield prediction

    • Knowledge transfer to other Cucurbitaceae crops

  • Emerging technologies with potential applications:

    • Nanoscale sensors for real-time monitoring of photosynthetic performance

    • Machine learning approaches for predicting D1 protein function from sequence

    • Synthetic biology platforms for redesigning photosynthetic complexes

    • Phenomics for comprehensive assessment of photosynthetic traits

These research directions will expand our understanding of how the psbA gene contributes to cucumber photosynthesis and stress responses, ultimately supporting crop improvement efforts.

How does research on cucumber psbA inform our understanding of photosynthesis in other crop species?

Research on cucumber psbA provides valuable insights that inform our understanding of photosynthesis across diverse crop species:

  • Evolutionary perspectives:

    • Cucumber represents the Cucurbitaceae family, offering comparative data with model systems

    • Analysis of domestication effects on photosynthetic genes reveals distinct patterns compared to grain crops

    • Identification of conserved vs. lineage-specific features of D1 protein function

  • Stress response mechanisms:

    • Cucumber responses to environmental stressors provide models for other crops

    • Unique adaptations in D1 protein turnover under various conditions offer comparative insights

    • Regulatory networks controlling psbA expression reveal both conserved and divergent features

  • Methodological advances with broad applications:

    • Techniques developed for cucumber chloroplast transformation can be adapted for other species

    • Approaches for analyzing D1 protein function provide templates for studies in diverse crops

    • Bioinformatic methods for analyzing psbA variation are applicable across species

  • Translational implications:

    • Genetic engineering strategies successful in cucumber may inform approaches in other crops

    • Identification of beneficial psbA variants guides selection in multiple species

    • Understanding of structure-function relationships in D1 protein has universal applications

  • Comparative genomic insights:

    • Cucumber's relatively simple genome structure facilitates comparative analyses

    • Patterns of genetic bottlenecks during domestication inform crop evolution studies

    • Identification of selective sweeps reveals general principles of crop domestication

These cross-species insights contribute to a comprehensive understanding of photosynthetic processes across plant lineages, ultimately supporting broad crop improvement efforts targeting enhanced photosynthetic efficiency and stress resilience.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.