Recombinant Cupixi virus Pre-glycoprotein polyprotein GP complex (GPC)

Shipped with Ice Packs
In Stock

Description

General Overview

Recombinant Cupixi virus Pre-glycoprotein polyprotein GP complex (GPC) is a crucial component of the Cupixi mammarenavirus, specifically involved in the virus's entry into host cells . As a pre-glycoprotein polyprotein, GPC is processed into three chains: the stable signal peptide (SSP), glycoprotein G1 (GP1), and glycoprotein G2 (GP2) .

Structure and Components

The GPC is initially synthesized as a single polypeptide, which is then cleaved into the GP1 and GP2 subunits by the cellular proprotein convertase site 1 protease (S1P) . The GPC forms a spike structure on the virus surface, facilitating receptor binding and cell entry .

The three main components of the GPC are:

  • Stable Signal Peptide (SSP): Functions as a signal peptide and is retained as a component of the GP complex. It is essential for efficient glycoprotein expression, post-translational maturation cleavage of GP1 and GP2, glycoprotein transport to the cell surface plasma membrane, formation of infectious virus particles, and acid pH-dependent glycoprotein-mediated cell fusion .

  • Glycoprotein G1 (GP1): Interacts with the host receptor, mediating virus attachment, specifically to host receptor alpha-dystroglycan DAG1. This attachment induces virion internalization, predominantly through clathrin- and caveolin-independent endocytosis .

  • Glycoprotein G2 (GP2): Functions as a Class I viral fusion protein that directs the fusion of viral and host endosomal membranes, leading to the delivery of the nucleocapsid into the cytoplasm. Membrane fusion is mediated by irreversible conformational changes induced upon acidification in the endosome .

Role in Viral Entry and Virulence

The glycoprotein complex (GPC) mediates viral entry and is the sole target for neutralizing antibodies . The SSP plays an essential role in mediating the membrane fusion step during viral infection and contributes to viral virulence . Specific residues within the SSP, such as K33, F49, and C57, are essential for GPC-mediated cell entry .

Post-translational Modifications

N-linked glycosylation is a significant post-translational modification, accounting for 40% of the mass of GTOV GP2 . Glycosylation plays a vital role in mammarenavirus GPC expression, maturation, receptor binding, membrane fusion, and immune evasion . GP1 contains 4–11 predicted N-glycosylation sites, while GP2 has four highly conserved N-glycosylation sites, with some exceptions in Lunk virus, LCMV, and Latino virus .

Research Findings and Significance

Research has demonstrated that the SSP plays an essential role in mediating the membrane fusion step as well as in other processes during viral infection . Targeting the proteolytic processing of the GPC is considered a promising antiviral strategy against arenaviruses .

Antiviral Strategies

Inhibiting the cellular proprotein convertase site 1 protease (S1P) is a potential antiviral approach.阻The S1P processes the GP precursor (GPC), which is crucial for cell-to-cell propagation of infection and the production of infectious virus. Inhibitors like decanoyl (dec)-RRLL-chloromethylketone (CMK) can block viral spread and virus production . Combining protease inhibitors with ribavirin, a drug used for treating human arenavirus infections, can result in additive drug effects .

Tables

Table 1: Functional Roles of GPC Components

ComponentFunction
SSPMediates viral entry, membrane fusion, and contributes to viral virulence. Required for glycoprotein expression, post-translational maturation, transport to the cell surface, formation of infectious virus particles, and acid pH-dependent cell fusion .
GP1Interacts with the host receptor alpha-dystroglycan DAG1, mediating virus attachment and virion internalization .
GP2Directs fusion of viral and host endosomal membranes, leading to the delivery of the nucleocapsid into the cytoplasm. Membrane fusion is mediated by conformational changes upon acidification .

Table 2: N-linked Glycosylation Sites in Mammarenavirus GPC

GlycoproteinN-Glycosylation Sites
GP1Contains 4–11 predicted N-glycosylation sites; positions vary considerably among different mammarenaviruses .
GP2Four highly conserved N-glycosylation sites, with some exceptions: Lunk virus and LCMV lack the second site, and Latino virus lacks the third site .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
GPC; GP-C; Pre-glycoprotein polyprotein GP complex; Pre-GP-C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
247-480
Protein Length
Full Length of Mature Protein
Species
Cupixi mammarenavirus (isolate Rat/Brasil/BeAn 119303/1970) (CPXV)
Target Names
GPC
Target Protein Sequence
AFFSWSLSDSTGVDMPGGYCLEKWMLIASELKCFGNTALAKCNLKHDSEFCDMIKLFDFN KNAISKLNNNTIEAVNQLTKTVNSLISDNLLMKNRLRELLKVPYCNYTRFWYVNHTRTGE HSLPKCWLVNNGSYLNESDFRNEWILESDHLISEMLSKEYQERQGRTPLTLVDLCFWSAV FYTTTLFLHLVGFPTHRHISGEPCPLPHRLNRHGACNCGRFKRLKKPLVWYKHH
Uniprot No.

Target Background

Function
Recombinant Cupixi virus Pre-glycoprotein polyprotein GP complex (GPC) is a class I viral fusion protein that mediates fusion between viral and host endosomal membranes, delivering the nucleocapsid into the cytoplasm. This fusion is driven by irreversible conformational changes induced by endosomal acidification. The stable signal peptide (SSP) is cleaved and functions as a signal peptide; it is also retained as a component of the GP complex. The SSP is crucial for efficient glycoprotein expression, post-translational maturation cleavage of GP1 and GP2, glycoprotein transport to the cell surface, infectious virion formation, and acid pH-dependent glycoprotein-mediated cell fusion. The protein interacts with the host receptor.
Database Links

KEGG: vg:5848389

Protein Families
Arenaviridae GPC protein family
Subcellular Location
[Glycoprotein G1]: Virion membrane; Peripheral membrane protein. Host endoplasmic reticulum membrane; Peripheral membrane protein. Host Golgi apparatus membrane; Peripheral membrane protein. Host cell membrane; Peripheral membrane protein.; [Glycoprotein G2]: Virion membrane; Single-pass membrane protein. Host endoplasmic reticulum membrane; Single-pass membrane protein. Host Golgi apparatus membrane; Single-pass membrane protein. Host cell membrane; Single-pass membrane protein.; [Stable signal peptide]: Virion membrane; Multi-pass membrane protein. Host endoplasmic reticulum membrane; Multi-pass membrane protein. Host Golgi apparatus membrane; Multi-pass membrane protein. Host cell membrane; Multi-pass membrane protein.

Q&A

What is the Cupixi mammarenavirus GPC and its role in viral infection?

The Cupixi mammarenavirus (CPXV) Pre-glycoprotein polyprotein GP complex (GPC) is a viral envelope protein essential for host cell infection. Like other arenaviruses, the GPC is initially synthesized as a single polypeptide precursor that undergoes post-translational processing to yield mature glycoproteins required for viral entry .

The GPC consists of three main components after processing:

  • Stable signal peptide (SSP): Unusually retained after processing, plays roles beyond typical signal sequences

  • Glycoprotein 1 (G1/GP1): Mediates receptor binding to initiate viral entry

  • Glycoprotein 2 (G2/GP2): Functions as a class I viral fusion protein, directing fusion of viral and host endosomal membranes

This complex orchestrates the critical early steps of viral infection, with GP1 mediating attachment to cellular receptors while GP2 facilitates membrane fusion upon endosomal acidification. The proper processing and function of GPC are key determinants of viral infectivity, host range, and pathogenesis .

How is the GPC processed during the viral lifecycle?

Processing of arenavirus GPC follows a specific pathway that is critical for viral infectivity:

  • Initial synthesis as a single polypeptide precursor

  • Cleavage by cellular signal peptidases, with unusual retention of the stable signal peptide (SSP)

  • Critical proteolytic processing by the cellular subtilisin kexin isozyme-1/site-1 protease (SKI-1/S1P)

The SKI-1/S1P cleavage generates:

  • The N-terminal GP1 involved in receptor binding

  • The C-terminal GP2 that mediates membrane fusion

Both cleavage events are essential for viral infectivity. The processed GP1, GP2, and SSP form a mature trimeric glycoprotein spike on the viral surface. During infection, low pH in the endosome triggers conformational changes that lead to shedding of GP1 and activation of GP2's fusion activity . This fusion mechanism delivers the viral genome into the host cell cytoplasm, initiating infection.

What expression systems are commonly used for recombinant production of arenavirus GPCs?

Several expression systems can be employed for recombinant production of arenavirus GPCs, each with distinct advantages:

Expression SystemAdvantagesLimitationsApplications
E. coli- High yield
- Cost-effective
- Well-established purification methods
- Suitable for protein fragments
- Lacks post-translational modifications
- Potential improper folding
- Inclusion body formation
- Production of antigen fragments
- Biochemical studies
- Antibody generation
Vaccinia Virus- Proper eukaryotic post-translational modifications
- High-level expression
- Handles large proteins
- More complex methodology
- Requires specialized facilities
- Safety considerations
- Functional studies
- Structure-function analysis
- Membrane protein expression
Mammalian Cells- Native-like glycosylation
- Proper folding and processing
- Authentic SKI-1/S1P processing
- Lower yields
- Higher cost
- More time-consuming
- Virus-host interaction studies
- Drug screening
- Neutralization assays

For Cupixi virus GPC specifically, E. coli expression has been validated for producing fragments (247-480 aa) with His-tag or tag-free options, suitable for biochemical and immunological studies . The recombinant vaccinia virus system provides an alternative for expressing functional glycoproteins, especially when proper folding and processing are critical .

What are the optimal conditions for expression and purification of functional Cupixi virus GPC?

Optimization of expression and purification conditions depends on the experimental goals and expression system selected:

For E. coli Expression:

  • Construct design considerations:

    • Express specific domains rather than full-length GPC

    • Use codon optimization for enhanced expression

    • Include solubility-enhancing tags (His, MBP, GST)

  • Expression optimization:

    • Induction temperature: Lower temperatures (16-20°C) often improve folding

    • IPTG concentration: Typically 0.1-0.5 mM for balanced yield/solubility

    • Expression duration: 4-16 hours depending on construct stability

  • Purification strategy:

    • Initial capture: IMAC (His-tag) or GST affinity chromatography

    • Secondary purification: Ion exchange chromatography

    • Polishing: Size exclusion chromatography

    • Validation: SDS-PAGE with >90% purity

For Vaccinia Virus-Based Expression:

  • Vector construction process:

    • Use NEBbuilder HiFi Assembly for cloning

    • Design PCR primers for the GPC sequence

    • Clone into an appropriate vaccinia transfer vector (pRB21)

  • Recombinant virus generation:

    • Infect BS-C-1 cells with vaccinia virus (vRB12)

    • Transfect with GPC-containing transfer vector

    • Select recombinant viruses through plaque size assessment

    • Perform three rounds of plaque purification for homogeneity

  • Expression and extraction:

    • Infect appropriate cells (BS-C-1 or other permissive lines)

    • Optimize multiplicity of infection (MOI) and harvest time

    • Use appropriate cell lysis buffers with protease inhibitors

    • Implement detergent screening for membrane protein solubilization

  • Functional validation:

    • Binding ability in functional ELISA

    • Western blotting with domain-specific antibodies

    • Conformational antibody recognition assays

How does the processing of Cupixi virus GPC by SKI-1/S1P compare to other arenaviruses?

The processing of arenavirus GPCs by SKI-1/S1P shows both conservation and variation across virus species, with implications for host range and pathogenicity:

AspectOld World Arenaviruses (e.g., LCMV, Lassa)New World Arenaviruses (Including Cupixi)Significance
Recognition motif(R/K)X(hydrophobic)X↓Variations in consensus sequenceAffects processing efficiency and potentially virus-host coevolution
Processing compartmentEarly Golgi to cell surfaceMay have distinct trafficking patternsInfluences viral assembly and maturation
SSP characteristicsCritical for transport and processingShows sequence diversity between virusesAffects GPC maturation efficiency
GP1-GP2 interactionsExtensive interactions in pre-fusion stateSimilar structural principles with sequence variationImpacts stability and fusion triggering

While specific comparative data for Cupixi virus is limited in the search results, general principles apply:

  • Recognition sequence variation: Differences in the SKI-1/S1P recognition motif can affect processing efficiency, potentially impacting viral fitness in different hosts .

  • SSP-GP2 interactions: The stable signal peptide interacts with GP2 to modulate fusion activation, and these interactions represent targets for viral fusion inhibitors .

  • Evolutionary considerations: The ability of emerging arenaviruses to effectively utilize human SKI-1/S1P is a critical determinant of zoonotic potential .

Methodological approaches for comparative studies include:

  • In vitro processing assays with recombinant SKI-1/S1P

  • Pulse-chase experiments to track processing kinetics

  • Mutagenesis of cleavage sites to assess recognition requirements

  • Cross-species analysis of SKI-1/S1P compatibility

What are the methodological approaches to assess functional activity of recombinant GPC?

Multiple complementary approaches can be employed to evaluate the functional integrity of recombinant Cupixi virus GPC:

Method TypeSpecific TechniquesMeasured ParametersConsiderations
Binding Assays- Functional ELISA
- Surface Plasmon Resonance
- Bio-layer interferometry
- Binding affinity (KD)
- Association/dissociation rates
- Thermodynamics
- Requires purified receptor
- Immobilization strategy impacts results
- Buffer conditions critical
Structural Assessment- Circular dichroism
- Thermal shift assays
- Limited proteolysis
- Secondary structure
- Thermal stability
- Conformational integrity
- Referenced standards needed
- Multiple techniques provide complementary data
- Expression tags may influence results
Fusion Activity- Cell-cell fusion assays
- Liposome fusion assays
- pH-induced conformational change
- Fusion efficiency
- Kinetics of fusion
- Conformational transitions
- pH dependence must be characterized
- Membrane composition influences activity
- Requires specialized equipment
Imaging Approaches- Immunofluorescence
- Live cell imaging
- Electron microscopy
- Subcellular localization
- Trafficking
- Oligomeric structure
- Antibody specificity critical
- Fixation may alter conformation
- Resolution limitations

For Cupixi virus GPC specifically, functional ELISA has been validated to determine binding ability . This represents a starting point for functional characterization, which should be expanded with additional techniques for comprehensive assessment.

Key methodological considerations include:

  • Design appropriate positive and negative controls

  • Validate that recombinant proteins maintain native-like properties

  • Assess both wild-type and mutant variants to identify functional determinants

  • Consider the impact of tags or fusion partners on function

How can researchers design inhibitors targeting GPC processing as potential antiviral strategies?

The critical role of SKI-1/S1P in arenavirus GPC processing makes it an attractive target for therapeutic intervention . Several approaches can be pursued:

  • Direct SKI-1/S1P Inhibitor Development:

    • Structure-based design targeting the catalytic site

    • Peptidomimetic compounds based on GPC cleavage recognition motifs

    • Allosteric inhibitors affecting enzyme conformation

    • High-throughput screening of compound libraries

  • GPC-Specific Targeting Strategies:

    • Peptides or small molecules blocking the GPC cleavage site

    • Compounds stabilizing fusion-incompetent GPC conformations

    • Antibodies recognizing and blocking processing sites

    • Development of decoy substrates

  • Rational Drug Design Workflow:

StageMethodsConsiderationsOutputs
Target Validation- Mutagenesis
- Cell-based assays
- Animal models
- Confirm essential role
- Assess cellular effects
- Evaluate therapeutic window
- Validated molecular target
- Understanding of mechanism
- Selection of assay systems
Assay Development- FRET-based protease assays
- Cell-based reporter systems
- Viral replication assays
- Assay robustness (Z-factor)
- Throughput requirements
- Physiological relevance
- Primary screening assay
- Secondary confirmation assays
- Counter-screening systems
Compound Screening- Fragment-based screening
- Virtual screening
- Focused library approaches
- Library diversity
- Physicochemical properties
- Computational docking methods
- Hit compounds
- Structure-activity relationships
- Lead series identification
Lead Optimization- Medicinal chemistry
- Structure-activity studies
- ADME profiling
- Potency enhancement
- Selectivity improvement
- Pharmacokinetic properties
- Optimized lead compounds
- Pre-clinical candidates
- Development strategy
  • Challenges and Considerations:

    • Selectivity: SKI-1/S1P processes cellular substrates in important physiological processes

    • Cellular accessibility: Compounds must reach appropriate subcellular compartments

    • Resistance development: Viral mutations may confer resistance

The search results highlight that "the crucial role of SKI-1/S1P in arenavirus infection and other major human diseases combined with its nature as an enzyme makes SKI-1/S1P further an attractive target for therapeutic intervention" . This dual relevance enhances the value of inhibitor development efforts.

What are the challenges in structural analysis of recombinant arenavirus GPCs?

Structural characterization of arenavirus GPCs presents several significant challenges that require specialized approaches:

  • Conformational Complexity:

    • Pre-fusion state represents a metastable conformation

    • Trimeric architecture with extensive subunit interactions

    • pH-triggered conformational changes complicate structure determination

  • Post-translational Modifications:

    • Glycosylation patterns impact folding, function, and crystallization

    • Expression system selection critically influences modification patterns

    • Bacterial systems (like E. coli) lack glycosylation machinery

  • Membrane Association:

    • Transmembrane domains in GP2 require membrane mimetics

    • Detergent selection impacts protein stability and structure

    • Native lipid environment may be required for authentic conformation

  • Multi-component Assembly:

    • Proper SSP association is difficult to recapitulate in recombinant systems

    • SSP-GP2 interactions critical for function and structure

    • Coordinated expression of all components presents technical challenges

ChallengeTechnical ApproachesExample MethodsConsiderations
Metastable Conformations- Protein engineering
- Antibody stabilization
- Chemical crosslinking
- Disulfide bond introduction
- Fusion with stabilizing domains
- Co-crystallization with Fabs
- Modifications may alter native structure
- Validation of biological relevance
- Resolution limitations
Glycosylation Heterogeneity- Glycosylation site mutation
- Enzymatic deglycosylation
- Glycosylation-compatible expression
- EndoH treatment
- PNGase F digestion
- Insect/mammalian expression
- Impact on folding and function
- Crystallization interference
- Expression yield reduction
Membrane Integration- Detergent screening
- Nanodiscs/bicelles
- Crystallization in lipidic cubic phase
- Electron microscopy in nanodiscs
- LCP crystallization
- Amphipol stabilization
- Detergent artifacts
- Lipid composition effects
- Technology-specific limitations
Multi-component complexity- Co-expression strategies
- Sequential purification
- Reconstitution approaches
- Polycistronic expression
- Affinity tag engineering
- In vitro assembly
- Stoichiometry control
- Component stability
- Assembly efficiency

Structural insights from related arenaviruses reveal that:

  • LCMV GP1 alone cannot bind its receptor with high affinity

  • The quaternary structure of the pre-fusion trimer may be required for receptor binding

  • The post-fusion conformation of GP2 forms a six-helix bundle similar to other class I fusion proteins

These observations highlight the importance of preserving native-like quaternary structure in recombinant expression systems for meaningful structural and functional studies.

How can recombinant GPC be used in the development of diagnostic tools and vaccines?

Recombinant Cupixi virus GPC offers numerous applications in diagnostics and vaccine development:

Diagnostic Applications:

  • Serological Assays:

    • ELISA-based detection of virus-specific antibodies using recombinant GPC antigens

    • Western blot confirmation assays for specificity validation

    • Immunoprecipitation for detecting antibodies in complex samples

  • Multiplexed Diagnostics:

    • Inclusion in arenavirus panels for differential diagnosis

    • Bead-based multiplex assays for simultaneous testing

    • Microarray formats for high-throughput screening

  • Point-of-Care Development:

    • Lateral flow assays using recombinant GPC fragments

    • Electrochemical biosensors with immobilized GPC

    • Smartphone-based diagnostic platforms

Vaccine Development Applications:

ApproachMethodologyAdvantagesChallenges
Subunit Vaccines- Recombinant GPC as immunogen
- Structure-guided epitope selection
- Adjuvant formulation
- Defined composition
- Safety profile
- Manufacturing consistency
- May require multiple doses
- Adjuvant dependence
- Potential conformational issues
Viral Vector Vaccines- GPC expression from viral vectors
- Vaccinia-based delivery systems
- Prime-boost strategies
- Strong immune responses
- Endogenous processing
- Broad immunity
- Pre-existing vector immunity
- Complex manufacturing
- Regulatory considerations
DNA/RNA Vaccines- GPC-encoding nucleic acids
- Lipid nanoparticle delivery
- Codon optimization
- Rapid development
- No infectious components
- Stability advantages
- Delivery efficiency
- Expression variability
- Novel technology concerns

Methodological Considerations:

  • Antigen Design:

    • Full-length vs. domain-specific constructs

    • Stabilization of neutralization-sensitive epitopes

    • Glycosylation engineering for optimal immunogenicity

  • Production Parameters:

    • Expression system selection impacts immunogenicity

    • Purification methods must preserve conformational epitopes

    • Formulation and stability affect vaccine efficacy

  • Immune Response Assessment:

    • Antibody titer measurement

    • Neutralization vs. binding antibody ratios

    • T cell response characterization

    • Durability of protective immunity

The development of successful diagnostics and vaccines requires careful optimization of recombinant GPC production to ensure authentic structure and antigenicity while maintaining cost-effective scalability for widespread application.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.