Recombinant Cupriavidus necator Glycerol-3-phosphate acyltransferase (plsY)

What is Cupriavidus necator Glycerol-3-phosphate acyltransferase (plsY) and what is its function?

Glycerol-3-phosphate acyltransferase (plsY) from Cupriavidus necator is an enzyme that catalyzes the transfer of an acyl group to glycerol-3-phosphate, representing the first step in phospholipid biosynthesis. The enzyme is also known by several alternative names including Acyl-PO4 G3P acyltransferase, Acyl-phosphate--glycerol-3-phosphate acyltransferase, and G3P acyltransferase (GPAT), with the Enzyme Commission number EC 2.3.1.n3 . The plsY gene in C. necator has the ordered locus name H16_A0588, and the protein sequence consists of 202 amino acids . This enzyme is essential for membrane phospholipid synthesis, making it a critical component of cellular metabolism and a potential target for metabolic engineering applications.

What is the structural composition of recombinant C. necator plsY protein?

The recombinant Cupriavidus necator plsY protein consists of 202 amino acids with the following sequence: MANLLFALAAYLIGSVSFAVVVSKLMGLPDPHSYGSGNPGATNVLRTGNKKAAILTLIGDALKGWLAVWLAARFGPAYGLNETGLAMVALAVFLGHLFPVYHRFAGGKGVATAAGILLAIDPILGLGTLATWLIIAFFFRYSSLAALVAAIFAPFFHVLMNGVDVMTGAIFVISVLLIARHRQNIAKLLAGKESRIGEKKKV . Analysis of this sequence indicates that plsY contains multiple transmembrane regions, consistent with its role in membrane phospholipid biosynthesis. The protein has a UniProt accession number of Q0KE35, which provides standardized identification for further bioinformatic analyses . When expressed recombinantly, the protein is typically supplied with specific tags to facilitate purification and detection, though the exact tag type may vary depending on the production process and intended research application.

How does C. necator plsY compare to similar enzymes in other bacterial species?

Glycerol-3-phosphate acyltransferase (plsY) belongs to a family of enzymes found across diverse bacterial species, but C. necator plsY exhibits distinct characteristics reflective of its host organism's unique metabolism. Unlike the well-characterized plsY homologs from model organisms such as Escherichia coli, the C. necator variant has adapted to function within the context of a metabolically versatile bacterium capable of both heterotrophic and autotrophic growth . Sequence alignment studies reveal conserved catalytic domains across bacterial plsY proteins, though the C. necator variant shows specific adaptations potentially related to its function in an organism with a high GC content genome (66.36%) . The enzyme's role must be understood within the broader metabolic network of C. necator, which includes specialized pathways such as the Calvin-Benson-Bassham cycle for carbon dioxide fixation during autotrophic growth, distinguishing it from homologs in obligate heterotrophs .

What are the optimal storage and handling conditions for recombinant C. necator plsY?

For optimal stability and activity retention, recombinant C. necator plsY should be stored in a Tris-based buffer containing 50% glycerol, which has been specifically optimized for this protein . Long-term storage requires temperatures of -20°C, with extended preservation recommended at -80°C to minimize activity loss . When working with the enzyme, it is advisable to create small working aliquots to avoid repeated freeze-thaw cycles, which can significantly compromise protein integrity and catalytic performance . These working aliquots can be maintained at 4°C for up to one week without significant loss of activity, facilitating experimental workflows while preserving the bulk stock . For enzymological studies requiring extended timeframes, researchers should establish activity baselines at regular intervals to account for any potential time-dependent decrease in catalytic efficiency under their specific laboratory conditions.

What expression systems are most effective for producing recombinant C. necator plsY?

Successful expression of recombinant C. necator plsY requires careful consideration of host systems, codon optimization, and purification strategies. While commercial preparations utilize proprietary expression systems optimized for yield and activity , researchers developing in-house production protocols should consider several factors. For heterologous expression, E. coli-based systems remain popular, but codon optimization is essential due to the high GC content (66.36%) of the native C. necator genome . Recent studies on C. necator have demonstrated that codon optimization can significantly impact heterologous protein expression, as evidenced by experiments with reporter proteins like GFP and mCherry . Alternative expression hosts such as Pseudomonas species may offer advantages for membrane proteins like plsY due to their similar membrane composition. Regardless of the chosen system, fusion tags (His, GST, or MBP) typically facilitate purification, although tag removal may be necessary for certain functional studies to prevent interference with catalytic activity or membrane association.

What analytical methods are recommended for assessing C. necator plsY enzyme activity?

Accurate assessment of C. necator plsY activity requires specialized methods that account for its membrane association and substrate specificity. A comprehensive analytical approach involves both direct and indirect activity assays. Direct measurement typically employs a coupled spectrophotometric assay tracking either substrate consumption or product formation, with acyl-CoA or acyl-phosphate substrates being monitored at appropriate wavelengths. For enhanced sensitivity, researchers can utilize radiometric assays with 14C-labeled glycerol-3-phosphate or acyl donors, followed by thin-layer chromatography separation and scintillation counting of the lipid products. Mass spectrometry-based approaches provide more detailed product characterization, enabling identification of specific acyl chains transferred by the enzyme. When conducting these assays, it is crucial to include appropriate controls for spontaneous hydrolysis of acyl donors and to establish linear reaction conditions with respect to enzyme concentration and time. For membrane-associated enzymes like plsY, detergent selection becomes critical, with mild non-ionic detergents such as n-dodecyl-β-D-maltoside (DDM) often providing the best balance between solubilization and activity preservation.

How can C. necator plsY be manipulated for altered membrane lipid composition?

Engineering C. necator plsY presents opportunities for modifying membrane lipid profiles, which can enhance cellular resilience to industrial bioprocessing conditions. Since plsY catalyzes the first committed step in phospholipid biosynthesis, targeted mutations in its substrate-binding pocket can alter acyl chain selectivity . Structure-guided mutagenesis focusing on residues that interact with the acyl chain can shift specificity toward shorter, longer, or more unsaturated fatty acids. This approach requires detailed structural knowledge, potentially using homology modeling based on crystallized plsY homologs from other species. Alternatively, directed evolution strategies employing error-prone PCR and high-throughput screening can identify plsY variants with desired substrate preferences without requiring structural information. Successfully engineered plsY variants could create C. necator strains with modified membrane compositions optimized for specific growth conditions, such as increased temperature tolerance or solvent resistance. When implementing these modifications, researchers should monitor global effects on cell physiology, as altered membrane composition can impact numerous cellular processes including transport, signaling, and respiratory chain function.

What role does plsY play in polyhydroxyalkanoate (PHA) production in engineered C. necator strains?

The relationship between phospholipid biosynthesis via plsY and polyhydroxyalkanoate (PHA) production represents an important metabolic intersection in C. necator. Both pathways utilize similar precursors, particularly acyl-CoA intermediates, creating potential competition for carbon flux . In recombinant C. necator strains engineered for enhanced PHA production, plsY activity may influence available precursor pools. For example, in strains producing poly(3-hydroxybutyrate-co-3-hydroxypropionate) (poly(3HB-co-3HP)), which reached polymer contents of 14.30-19.27% of cell dry weight in experimental settings, the phospholipid synthesis pathway can divert acyl-CoA molecules that might otherwise contribute to PHA formation . This metabolic interplay suggests strategic opportunities for comprehensive pathway engineering. Researchers investigating the optimization of PHA production should consider modulating plsY expression levels to balance essential phospholipid synthesis with maximal carbon flux toward PHA production. Experimental approaches might include controlled downregulation of plsY using inducible promoter systems as described in recent C. necator synthetic biology toolkits, which have demonstrated a 50-fold range of expression for reporter genes .

How does plsY activity change under autotrophic versus heterotrophic growth conditions in C. necator?

Cupriavidus necator's metabolic versatility, which allows growth on diverse carbon sources including CO2 fixation via the Calvin-Benson-Bassham cycle during autotrophic conditions, raises important questions about plsY regulation under different growth regimes . The enzyme's activity likely undergoes significant adjustments as the organism transitions between heterotrophic growth on organic substrates (sugars, lipids, organic acids) via the Entner-Doudoroff pathway and autotrophic growth using hydrogen to power CO2 assimilation . Research protocols for investigating these regulatory patterns should include comparative enzyme activity assays from cells grown under strictly defined conditions, coupled with transcriptomic and proteomic analyses to identify regulatory mechanisms. Additionally, metabolic flux analysis using isotope-labeled substrates can reveal how carbon flow through the plsY-catalyzed reaction changes between growth modes. These studies have significant implications for metabolic engineering applications, as understanding this regulatory network could enable the design of strains with optimized membrane lipid synthesis regardless of carbon source, potentially improving the industrial applicability of C. necator as a platform organism for various biotechnological processes.

What strategies can be employed for targeted genome editing of plsY in C. necator?

Precise genome editing of the plsY gene in C. necator requires sophisticated molecular tools adapted to this non-model organism. CRISPR-Cas9 systems have been successfully adapted for C. necator, allowing for targeted modifications including point mutations, deletions, and insertions within the plsY locus (H16_A0588) . When designing a CRISPR-based approach, researchers should account for C. necator's high GC content (66.36%) when selecting guide RNAs to ensure specificity and efficiency . Alternative approaches include homologous recombination-based methods, which typically require longer homology arms (>500 bp) compared to model organisms due to the lower natural recombination efficiency in C. necator. For selection strategies, researchers can utilize established markers such as kanamycin resistance while being mindful of C. necator's intrinsic antibiotic resistance profile. To confirm successful genome editing, comprehensive validation should combine PCR-based genotyping, sequencing, and functional assays to verify both the genetic modification and its phenotypic consequences. When modifying essential genes like plsY, conditional approaches may be necessary, such as creating the modification in the presence of a complementing plasmid that can later be cured from the strain.

How can researchers effectively monitor plsY expression levels in C. necator?

Accurate monitoring of plsY expression in C. necator requires a multi-faceted approach combining transcriptomic, proteomic, and activity-based methods. At the transcriptional level, quantitative reverse transcription PCR (qRT-PCR) provides a sensitive method for measuring plsY mRNA levels, requiring careful primer design to account for C. necator's high GC content (66.36%) . RNA-seq offers a broader perspective, situating plsY expression within the global transcriptional landscape. At the protein level, western blotting with antibodies against plsY or epitope tags engineered into the protein sequence allows for direct quantification. For more precise measurements, targeted proteomics using multiple reaction monitoring mass spectrometry can provide absolute quantification of plsY protein. Reporter gene fusions, such as transcriptional or translational fusions to fluorescent proteins like GFP (which has been successfully expressed in C. necator with appropriate codon optimization), enable real-time monitoring of expression dynamics . Each method has specific advantages and limitations; therefore, combining complementary approaches provides the most comprehensive understanding of plsY expression under various experimental conditions.

What techniques are available for examining plsY protein-protein interactions in C. necator?

Investigating protein-protein interactions involving plsY in C. necator requires specialized approaches that account for its membrane-associated nature. Bacterial two-hybrid systems adapted for membrane proteins provide an in vivo screening method, though they typically require expression in heterologous hosts like E. coli. For more direct approaches in C. necator, proximity-dependent biotin identification (BioID) or its bacterial adaptations can identify interaction partners by fusing plsY to a biotin ligase that biotinylates nearby proteins, which are subsequently purified and identified by mass spectrometry. Co-immunoprecipitation with epitope-tagged plsY versions can also identify stable interaction partners, though membrane protein extraction requires careful optimization of detergent conditions to maintain interaction integrity. For putative interactions with specific targets, Förster resonance energy transfer (FRET) using fluorescent protein fusions can provide both confirmation and spatial information within living C. necator cells. When implementing these methods, researchers should consider potential artifacts introduced by overexpression or tagging of plsY, ideally validating key interactions through multiple independent techniques. Understanding these interaction networks is crucial for contextualizing plsY function within C. necator's broader metabolic framework, potentially revealing regulatory mechanisms and identifying additional engineering targets.

What are common challenges when working with recombinant C. necator plsY and how can they be addressed?

Researchers working with recombinant C. necator plsY commonly encounter several technical challenges that require specific troubleshooting strategies. Solubility issues often arise due to plsY's membrane-associated nature, resulting in protein aggregation during purification . This can be addressed by optimizing detergent selection, with mild non-ionic detergents like DDM or CHAPS typically showing better results than harsher alternatives. Additionally, using fusion partners like MBP can improve solubility. Activity loss during purification represents another frequent obstacle, potentially caused by detergent interference with substrate binding or disruption of necessary lipid interactions. Implementing activity assays at each purification step helps identify problematic conditions, and inclusion of specific phospholipids in the buffer can sometimes rescue activity. Stability problems during storage can be mitigated by the recommended storage conditions: Tris-based buffer with 50% glycerol at -20°C or -80°C, with working aliquots kept at 4°C for no more than one week . For applications requiring immobilized enzyme, coupling strategies must be carefully evaluated to preserve the active site orientation, with supports that allow some degree of protein mobility often showing superior performance for membrane-derived enzymes like plsY.

How can researchers optimize heterologous expression of C. necator plsY in different host systems?

Optimizing heterologous expression of C. necator plsY requires addressing several key considerations that impact yield and activity. Codon optimization is particularly important given C. necator's high GC content (66.36%), and should be tailored to the specific expression host . In E. coli expression systems, induction conditions significantly impact membrane protein yield, with lower temperatures (16-25°C) and reduced inducer concentrations often favoring proper folding over inclusion body formation. The choice of promoter system also merits careful consideration - while strong promoters like T7 maximize protein amounts, they often lead to aggregation for membrane proteins like plsY. Moderately strong or titratable promoter systems generally provide better results. Recent studies on C. necator gene expression have characterized promoter strengths, including inducible and constitutive options that show a 50-fold range of expression . Expression host selection represents another critical variable, with some researchers finding improved results using hosts with similar membrane compositions such as Pseudomonas species. When expressing in yeast systems, targeting signals may require modification for proper membrane insertion. For difficult-to-express constructs, fusion to fluorescent proteins enables rapid screening of expression conditions while providing real-time information on protein localization.

What experimental setup is recommended for kinetic characterization of C. necator plsY?

Comprehensive kinetic characterization of C. necator plsY requires careful experimental design to account for its membrane association and complex substrate interactions. An effective experimental setup begins with enzyme preparation in a form that maintains native-like membrane environment, either through mild detergent solubilization or reconstitution into liposomes or nanodiscs. For accurate kinetic measurements, researchers should establish assay conditions where enzyme concentration is limiting and product formation remains linear with time. Initial velocity determinations should be performed across a range of substrate concentrations for both acyl donors and glycerol-3-phosphate to determine Km and Vmax parameters. Temperature and pH optima should be systematically investigated, typically covering 25-50°C and pH 6.0-9.0 in appropriate buffer systems. For mechanistic studies, product inhibition experiments and dead-end inhibitor studies can distinguish between sequential and ping-pong mechanisms. When analyzing substrate specificity, a panel of acyl donors with varying chain lengths and saturation levels provides valuable insights into the enzyme's preference profile. Throughout these studies, researchers should be mindful of potential complications from detergent effects, substrate solubility limitations, and product inhibition. The resulting kinetic parameters should be presented in a comprehensive data table containing Km, kcat, and kcat/Km values for each substrate, along with confidence intervals from replicate measurements.