Recombinant Cupriavidus necator Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mscL; H16_A3399; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-141
Protein Length
full length protein
Species
Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) (Ralstonia eutropha)
Target Names
mscL
Target Protein Sequence
MGMISEFRTFAVRGNVIDLAVGVIIGAAFGKIVDSVVNDLIMPLVGRVIGKLDFSSMFIV LADPPPGTPTTLDALKKAGVPVFAYGNFLTIVVNFLILAFIIFLMVRAFNRMRAAEPEAA PAAPPEEVVLLREIRDSLKTR
Uniprot No.

Target Background

Function
A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a role in regulating cellular osmotic pressure.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the mscL gene in Cupriavidus necator and how was it identified?

The mscL gene in C. necator encodes the large-conductance mechanosensitive channel protein that functions primarily as a pressure-relief valve during hypoosmotic shock. This gene was identified in the C. necator genome through protein BLAST searches using the homologous gene found in Escherichia coli as a query sequence . Like other prokaryotic mscL proteins, the C. necator mscL responds to increases in membrane tension by opening a nonselective pore approximately 30Å wide, exhibiting a large unitary conductance of approximately 3 nS . The identification of this gene has enabled researchers to study its role in osmotic regulation and potential biotechnological applications specific to C. necator.

How does deletion of the mscL gene affect C. necator cell physiology?

The deletion of the mscL gene from C. necator significantly increases the cell's susceptibility to osmotic downshock without affecting normal growth. Experimental data shows:

StrainGrowth Rate (h⁻¹)Osmolysis Efficiency (in distilled water)
C. necator H16 (wild-type)0.45 ± 0.0119%
C. necator H16 ΔmscL0.43 ± 0.0162%

What is the physiological function of the mscL channel in bacteria?

The mscL channel functions as a biological pressure-relief valve that protects bacterial cells from lysing during acute osmotic downshock. When bacteria experience a sudden decrease in external osmolarity (such as during rainfall or when transferred from a high-salt to a low-salt environment), water rapidly enters the cell, increasing turgor pressure and threatening cell integrity . The mscL channel responds to the resultant increase in membrane tension by opening a large, nonselective pore that allows the rapid efflux of cytoplasmic solutes, thereby reducing internal pressure and preventing cell rupture . This protective mechanism is crucial for bacterial survival in environments with fluctuating osmolarity.

What molecular mechanisms govern the gating process of the mscL channel?

The gating process of the mscL channel involves coordinated movements of multiple structural elements. According to the helix-pivoting model supported by structural studies, the transition from the closed state to the expanded state occurs through:

  • Significant changes in the tilt angles of the two transmembrane helices (TM1 and TM2), which follow a geometric relationship described by the equations:

    cosα = cos²η + sin²η·cosθ
    R = d(tanη·cot(α/2) - 1)/2

    Where α is the interhelical-crossing angle, η is the tilt angle of the TM1 helix with respect to the pore axis, θ is 72° for a pentameric channel, R is the minimum pore radius, and d is the diameter of a transmembrane helix .

  • Transformation of the periplasmic loop region from a folded structure (containing an ω-shaped loop and a short β-hairpin) to an extended and partly disordered conformation .

  • Rotating and sliding movements of the N-terminal helix (N-helix) coupled to the tilting movements of TM1 and TM2. The N-helix serves as a membrane-anchored stopper that limits the tilts of TM1 and TM2 during gating .

These coordinated conformational changes enable the channel to open a large pore in response to increased membrane tension, allowing the rapid efflux of cytoplasmic contents to relieve osmotic pressure.

How can researchers optimize genetic manipulation of the mscL gene in C. necator?

Based on successful protocols, researchers can optimize mscL gene deletion in C. necator through:

  • Vector selection and construction: Use integrative plasmids like pMQ30k for gene deletion. A gene fragment containing 500-nucleotide regions matching the upstream and downstream regions of the mscL gene should be synthesized and assembled with the linearized vector by Gibson Assembly .

  • Transformation approach: Conjugation using a donor strain (like WM3064) has proven effective for transferring the deletion construct into C. necator H16 strains .

  • Selection strategy: A two-step selection process is optimal:

    • First selection on kanamycin (200 μg/mL) to identify cells that have integrated the plasmid

    • Counterselection on medium containing 15% (w/v) sucrose to identify cells that have lost the plasmid through a second recombination event

  • Verification methods: Colony PCR followed by Sanger sequencing provides reliable confirmation of successful gene deletion .

For researchers working with E. coli, the lambda Red recombination system offers an alternative approach, utilizing a kanamycin resistance gene flanked by FRT sites and homology arms matching regions upstream and downstream of the mscL gene .

What strategies can enhance osmolysis susceptibility in C. necator for biotechnological applications?

Two complementary strategies have been developed to increase osmolysis susceptibility in C. necator:

  • Genetic engineering approach: Deletion of the mscL gene significantly increases osmolysis efficiency from 19% in wild-type to 62% in the ΔmscL strain when cells are exposed to distilled water .

  • Adaptive Laboratory Evolution (ALE): Evolving C. necator to become halotolerant by gradually increasing salt concentration in growth media. This adaptation allows cells to grow in higher salt concentrations, thereby increasing the potential osmotic differential when cells are subsequently exposed to low-osmolarity solutions .

  • Combined approach: The most effective strategy combines both approaches. When the mscL gene was deleted from the halotolerant ht030b strain, osmolysis efficiency increased to over 90% upon resuspension in distilled water . This represents a significant improvement over either strategy alone and provides a powerful tool for applications requiring efficient release of intracellular products.

StrategyOsmolysis Efficiency
Wild-type C. necator19%
C. necator ΔmscL62%
Halotolerant C. necator (ht030b)Higher than wild-type
ht030b ΔmscL>90%

How can researchers quantitatively measure osmolysis efficiency in C. necator?

A robust RFP-based lysis assay has been developed to quantitatively measure osmolysis efficiency in C. necator:

  • Preparation of reporter strain: Transform the C. necator strain of interest with an expression vector containing an inducible RFP gene (e.g., pBADTrfp with an arabinose-inducible promoter) via conjugation .

  • Cell culture and RFP expression:

    • For heterotrophic growth: Grow cells overnight in LB with appropriate salt concentration (1.5% for non-halotolerant strains, 3.0% for halotolerant strains)

    • For organoautotrophic growth: Grow cells in M9 minimal salts medium supplemented with 4 g/L sodium formate and 6 g/L NaCl (non-halotolerant) or 16 g/L NaCl (halotolerant)

    • Induce RFP expression with arabinose (1 mg/mL) overnight at room temperature

  • Osmotic downshock procedure:

    • Harvest and wash cells

    • Resuspend cell pellets in solutions of various osmolarities (e.g., distilled water, 0.5%, 1%, or 1.5% NaCl)

    • Incubate for 30 minutes at room temperature

  • Quantification:

    • Pellet cells by centrifugation

    • Measure red fluorescence intensity in both the supernatant and the whole solution

    • Calculate osmolysis efficiency as the ratio of fluorescence in the supernatant to that in the whole solution

This method provides a direct and quantitative measurement of the fraction of cells lysed due to osmotic downshock, enabling precise comparison between different strains and conditions.

What controls should be included when studying mscL function in C. necator?

When studying mscL function in C. necator, the following controls are essential:

How does the magnitude of osmotic downshock relate to cell lysis efficiency?

The relationship between osmotic downshock magnitude and cell lysis efficiency is not strictly linear and depends on genetic factors. Experimental data reveals:

  • For both wild-type and ΔmscL strains, the highest osmolysis efficiency occurs with the greatest osmotic differential (cells grown in high salt then resuspended in distilled water) .

  • In wild-type C. necator, increasing the magnitude of osmotic downshock from 0 OsM (isotonic) to 0.51 OsM (water) increases lysis from <5% to 19% .

  • In the ΔmscL strain, the same increase in osmotic downshock magnitude results in a much steeper increase in lysis efficiency, from <5% to 62% .

  • When combining halotolerance and mscL deletion (ht030b ΔmscL), the relationship becomes even more pronounced, with >90% lysis efficiency at maximum osmotic differential .

What role does the periplasmic loop region play in mscL channel function?

The periplasmic loop region of the mscL channel significantly influences its gating kinetics and mechanosensitivity . Structural and functional analyses reveal:

  • Structural features: The periplasmic loop contains a folded region with an "ω"-shaped structure (ω-loop) and a short β-hairpin structure that follows it .

  • Functional significance:

    • In the closed state, the loop folds the polypeptide chain and inserts into the pore lumen

    • The ω-loop forms van der Waals contacts and hydrogen bonds with amino acid residues from the C-terminal end of TM1

    • The β-hairpin associates with the C-terminal end of TM1 and the ω-loop from an adjacent subunit

  • Role in channel gating:

    • The loop-TM1/TM1' interactions and the hydrogen bonds within the ω-loop and β-hairpin stabilize the channel in its closed state

    • During channel opening, the loop transforms from its folded structure to an extended and partly disordered conformation

    • Deletion of six residues (Gly51-Thr56) from the ω-loop region abolishes the channel's function during osmotic downshock

This evidence indicates that the periplasmic loop serves as a spring-like structure that provides both stability in the closed state and the flexibility required for channel opening during osmotic stress.

How might mscL modifications be leveraged for biotechnological applications?

The manipulation of mscL in C. necator presents several promising avenues for biotechnological applications:

  • Controlled product release: Engineered osmolysis susceptibility (>90% efficiency) in C. necator through mscL deletion combined with halotolerance adaptation offers a non-destructive method for recovering intracellular biomolecules without harsh chemical treatments .

  • Nanovalve development: Previous studies have demonstrated that MscL can be converted into a light-activated nanovalve useful for triggered release of compounds in liposomes, suggesting similar applications could be developed with C. necator mscL .

  • Antimicrobial development: The open pore of MscL permits entry of streptomycin and could serve as a target for antimicrobial agents, particularly if mscL-deficient strains show heightened antibiotic susceptibility .

  • Protein production platforms: Combining C. necator's ability to grow on various carbon sources (including formate) with enhanced osmolysis susceptibility could create efficient production platforms for proteins and other biomolecules with simplified downstream processing .

  • Biosensor development: The mechanosensitivity of mscL could potentially be harnessed to develop whole-cell biosensors for detecting mechanical forces or pressure changes in various environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.