Recombinant Cupriavidus necator NADH-quinone oxidoreductase subunit K (nuoK)

What is the structure and function of Cupriavidus necator NADH-quinone oxidoreductase subunit K (nuoK)?

The NADH-quinone oxidoreductase subunit K (nuoK) is a 101-amino acid protein component of the respiratory complex I in Cupriavidus necator. The complete amino acid sequence is: MLSLAHFLVLGAILFAISIVGIFLNRKNVIVLLMAIELMLLAVNINFVAFSHYLGDLAGQVFVFFILTVAAAESAIGLAILVVLFRNLDTINVDDMDTLKG .

This membrane-embedded protein forms part of the proton-translocating module of respiratory complex I. Based on its structure, nuoK contains three transmembrane helices that contribute to the formation of proton channels across the bacterial inner membrane. The protein functions in the electron transport chain, participating in energy conservation by coupling NADH oxidation to proton translocation, ultimately contributing to ATP synthesis via oxidative phosphorylation.

What expression systems are effective for producing recombinant Cupriavidus necator nuoK protein?

Escherichia coli has proven to be an effective heterologous expression system for recombinant Cupriavidus necator nuoK. The protein can be successfully expressed in E. coli with an N-terminal His-tag for purification purposes . This expression system allows for relatively straightforward protein production, as demonstrated by commercial recombinant nuoK preparations that achieve greater than 90% purity as determined by SDS-PAGE .

Additionally, research has shown that C. necator proteins, including hydrogenases, can be functionally expressed in E. coli, suggesting that proper folding and assembly of C. necator membrane proteins is possible in this host . The successful expression indicates that E. coli recognizes the regulatory elements and translation signals from C. necator genes.

How should recombinant nuoK protein be stored and handled to maintain stability?

Recombinant nuoK protein requires specific storage and handling conditions to maintain its structural integrity and activity. Based on established protocols, the following guidelines should be observed:

• Store the lyophilized powder at -20°C to -80°C upon receipt.

• After reconstitution, aliquot the protein to avoid repeated freeze-thaw cycles, which can lead to protein denaturation.

• Working aliquots may be stored at 4°C for up to one week.

• For reconstitution, use deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL.

• Addition of glycerol to a final concentration of 5-50% (optimally 50%) is recommended for long-term storage at -20°C/-80°C .

The protein is typically stored in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0, which helps maintain protein stability during storage .

How does the nuoK subunit interact with other components of the NADH-quinone oxidoreductase complex in C. necator?

The nuoK subunit forms critical interactions with several other subunits within the NADH-quinone oxidoreductase (Complex I) architecture. Based on structural homology with other bacterial Complex I systems, nuoK likely interfaces directly with nuoH, nuoJ, and nuoL subunits to form the membrane domain of the complex. The transmembrane helices of nuoK align with corresponding helices in adjacent subunits to create the proton translocation pathway.

Research indicates that in C. necator, Complex I contains several key subunits including NuoC, NuoD, NuoB, NuoI, and NuoG that interact with the membrane domain containing nuoK . The N-terminus and C-terminus regions of NuoG particularly contribute to electron transfer from the hydrophilic domain to the membrane domain where nuoK resides.

These interactions are essential for coupling electron transfer from NADH through the iron-sulfur clusters to the reduction of quinones, with concurrent proton translocation through the membrane domain containing nuoK.

What role does the nuoK subunit play in C. necator's metabolic versatility, particularly in autotrophic growth conditions?

The nuoK subunit, as part of the NADH-quinone oxidoreductase complex, plays a crucial role in C. necator's remarkable metabolic versatility, particularly during autotrophic growth. C. necator can grow on CO₂ + H₂ as carbon and energy sources, demonstrating its capacity for carbon fixation in the absence of organic carbon .

Under autotrophic conditions, the respiratory chain components, including nuoK-containing Complex I, must efficiently manage electron flow from hydrogen oxidation. Research has shown that the soluble [NiFe]-hydrogenase is particularly important for C. necator when grown autotrophically . This hydrogenase delivers electrons from H₂ oxidation to NAD⁺, generating NADH that feeds into the respiratory chain through Complex I (containing nuoK).

The importance of respiratory components in metabolic flexibility is further evidenced by studies showing that CO tolerance in C. necator depends on different respiratory components depending on growth conditions: the cytochrome bd ubiquinol oxidase during heterotrophic growth and the soluble [NiFe]-hydrogenase during autotrophic growth .

How can recombinant nuoK be integrated into synthetic electron transport chains for biotechnological applications?

Recombinant nuoK could potentially be integrated into synthetic electron transport chains through several strategic approaches:

• Chimeric Protein Engineering: Similar to the fusion between E. coli Hyd-3 and a ferredoxin from Thermotoga maritima that exhibited H₂ evolution , nuoK could be engineered as part of chimeric proteins that connect different electron transport modules.

• Heterologous Expression Systems: The demonstrated ability to express C. necator hydrogenases in E. coli suggests that functional nuoK-containing complexes could be assembled in heterologous hosts for specialized electron transport functions.

• Metabolic Rewiring: By co-expressing nuoK with other respiratory components, electron flow could be redirected to support production of specific metabolites. This approach might borrow from strategies used to engineer C. necator for improved polyhydroxyalkanoate production .

• Modular Assembly: Respiratory complexes could be designed with modified nuoK to alter proton translocation properties, potentially optimizing the proton motive force for specific applications.

The feasibility of these approaches is supported by successful engineering of C. necator strains for novel substrate utilization, such as the modification to use lactose-containing waste material for polyhydroxyalkanoate production .

What are the most effective purification techniques for isolating functional recombinant nuoK protein?

Purification of functional recombinant nuoK protein requires specialized techniques due to its membrane-associated nature. Based on established protocols and the information from search results, the following purification approach is recommended:

For functional studies, it's crucial to maintain the protein in conditions that preserve its native conformation. This may include reconstitution into liposomes or nanodiscs to provide a membrane-like environment that supports the proper folding and function of this integral membrane protein.

How can researchers effectively measure the activity of nuoK within the NADH-quinone oxidoreductase complex?

Assessing nuoK activity within the NADH-quinone oxidoreductase complex requires specialized techniques that measure electron transfer and proton translocation. Recommended methodological approaches include:

• NADH Oxidation Assays: Spectrophotometric monitoring of NADH oxidation rate at 340 nm in the presence of appropriate electron acceptors (e.g., ubiquinone analogs).

• Membrane Potential Measurements: Using voltage-sensitive fluorescent dyes (e.g., DiSC3(5)) to monitor the generation of membrane potential in proteoliposomes containing reconstituted complex.

• Proton Translocation Assays: Employing pH-sensitive fluorescent probes to detect proton movement across membranes during electron transfer.

• Oxygen Consumption Measurements: Using oxygen electrodes to measure respiratory activity in membrane preparations containing the complex.

• Site-Directed Mutagenesis: Creating specific mutations in nuoK to correlate structure with function, similar to approaches used to study cytochrome bd ubiquinol oxidase in C. necator .

A combined approach using multiple techniques provides the most comprehensive assessment of nuoK function within the complex.

What genetic engineering strategies can be employed to modify nuoK expression or function in C. necator?

Several genetic engineering strategies have proven effective for modifying gene expression or function in C. necator, which can be applied to nuoK research:

• Gene Replacement: Similar to the approach used for cytochrome bd oxidase modifications, researchers can introduce mutations by first creating a deletion (approximately 200 bp) and then repairing it with a sequence containing the desired mutation .

• Promoter Engineering: The G→A mutation upstream of cydA2B2 increased expression approximately 1000-fold regardless of growth conditions . Similar promoter modifications could be applied to nuoK to alter expression levels.

• Inducible Expression Systems: Arabinose-inducible promoters have been successfully used in C. necator . These could be adapted to control nuoK expression with:

  • 0.1 mM arabinose for moderate induction

  • 0.2 mM arabinose for higher induction

• Knock-Out/Knock-In Systems: Plasmids derived from pLO3 have been used effectively for gene modifications in C. necator . This approach allows for precise genetic alterations.

• CRISPR-Cas9 Genome Editing: While not explicitly mentioned in the search results, this technology has been adapted for many bacterial species and could provide precise editing of nuoK.

What analytical techniques can be used to investigate nuoK's role in electron transport and cellular respiration?

Investigating nuoK's role in electron transport and cellular respiration requires a combination of biochemical, biophysical, and genetic approaches:

By comparing wild-type and mutant strains under different growth conditions (e.g., heterotrophic vs. autotrophic), researchers can elucidate the specific contribution of nuoK to C. necator's metabolic versatility. This approach has been successfully used to characterize the role of cytochrome bd oxidase in CO tolerance .

How might nuoK engineering contribute to enhanced biohydrogen production in recombinant systems?

Engineering of nuoK could significantly contribute to enhanced biohydrogen production systems through several mechanisms:

The NADH-quinone oxidoreductase complex containing nuoK plays a critical role in maintaining cellular redox balance, which directly impacts hydrogen metabolism. Strategic modifications of nuoK could potentially redirect electron flow to hydrogen-producing pathways. Research has already demonstrated that heterologous expression of C. necator hydrogenases in E. coli can result in functional hydrogen-evolving systems .

A promising approach would involve integrating engineered nuoK into synthetic electron transport chains that specifically channel electrons to hydrogenases. This could be achieved by creating fusion proteins that directly connect nuoK-containing complexes to hydrogenases, similar to the chimeric system created between E. coli Hyd-3 and a ferredoxin from Thermotoga maritima that successfully produced hydrogen using pyruvate as an electron donor .

Additionally, nuoK variants could be designed to alter proton translocation efficiency, potentially increasing the proton gradient that drives ATP synthesis while simultaneously providing protons for hydrogen production by hydrogenases.

What insights can nuoK research provide for developing CO-tolerant strains of C. necator for syngas fermentation?

Research into nuoK and other respiratory chain components offers valuable insights for developing CO-tolerant C. necator strains for syngas fermentation:

Understanding how nuoK and the entire respiratory complex I respond to CO exposure could reveal potential engineering targets. Since CO tolerance under heterotrophic conditions was linked to the terminal respiratory cytochrome bd ubiquinol oxidase, while tolerance under autotrophic conditions depended on the soluble [NiFe]-hydrogenase , there may be specific interactions or compensatory mechanisms involving nuoK that could be exploited.

A systematic approach would involve analyzing how nuoK expression and activity change in CO-tolerant strains, potentially identifying mutations or expression patterns that confer resistance. These insights could guide rational engineering of respiratory components, including nuoK, to develop robust C. necator strains capable of efficiently converting syngas (containing CO, CO₂, and H₂) into valuable bioproducts.

How can nuoK research contribute to polyhydroxyalkanoate (PHA) production optimization?

Research on nuoK and respiratory chain components can significantly contribute to optimizing polyhydroxyalkanoate (PHA) production in C. necator through several mechanisms:

PHA production is intimately linked to cellular energy metabolism and redox balance, which are directly influenced by respiratory chain efficiency. The NADH-quinone oxidoreductase complex containing nuoK plays a central role in maintaining the NADH/NAD⁺ ratio, which affects carbon flux toward PHA synthesis.

C. necator is a well-known PHA producer, and genetic modifications have already demonstrated improved yields. For example, engineering C. necator DSM 545 to utilize lactose-containing waste materials involved disrupting the phaZ1 depolymerase gene and inserting E. coli lac genes, resulting in lower PHA degradation and higher yields .

Strategic engineering of nuoK could potentially:

• Optimize energy conservation during growth on alternative substrates

• Redirect electron flow to support optimal NADPH generation (required for PHA synthesis)

• Balance cell growth and PHA accumulation phases by modulating respiratory efficiency

• Enhance tolerance to inhibitory compounds present in waste streams used for PHA production

These approaches could complement existing strategies, such as the dual inactivation of PHA depolymerases (phaZ1 and phaZ3) that has shown promising results for increasing PHA yields .

What are common challenges in expressing and purifying functional nuoK protein, and how can they be addressed?

Expressing and purifying functional membrane proteins like nuoK presents several challenges. The following table outlines common issues and recommended solutions:

Based on the successful expression of C. necator proteins in E. coli , researchers should consider using specialized strains designed for membrane protein expression and incorporating the recommended storage conditions, including the addition of 5-50% glycerol and avoiding repeated freeze-thaw cycles .

How can researchers differentiate between the specific contributions of nuoK and other respiratory complex components in phenotypic studies?

Differentiating the specific contributions of nuoK from other respiratory complex components requires a systematic experimental approach:

• Gene Knockout Studies: Generate precise nuoK deletions using methods similar to those employed for cytochrome bd oxidase studies . Compare phenotypes with wild-type and strains lacking other respiratory components.

• Complementation Analysis: Restore nuoK expression in knockout strains using plasmid-based systems with varying expression levels. This approach can determine whether phenotypes are directly linked to nuoK function.

• Point Mutations: Generate specific amino acid substitutions in functionally important regions of nuoK to disrupt specific activities while maintaining protein expression and complex assembly.

• Reporter Fusions: Create transcriptional and translational fusions with reporter genes (e.g., GFP) to monitor expression patterns under different conditions, similar to the fluorescence measurements used for cytochrome bd oxidase expression studies .

• Comparative Growth Analysis: Assess growth under various conditions, including different carbon sources and stress conditions, comparing multiple respiratory chain mutants to identify nuoK-specific phenotypes.

This multi-faceted approach allows researchers to distinguish direct effects of nuoK from compensatory mechanisms or indirect effects involving other respiratory components.