Recombinant Cupriavidus necator Probable Ni/Fe-hydrogenase B-type cytochrome subunit (hoxZ)

Shipped with Ice Packs
In Stock

Description

Introduction to hoxZ Protein

The Probable Ni/Fe-hydrogenase B-type cytochrome subunit, encoded by the hoxZ gene in Cupriavidus necator (previously known as Ralstonia eutropha), is an essential component of the membrane-bound [NiFe]-hydrogenase complex. This complex plays a fundamental role in hydrogen metabolism, catalyzing the reversible oxidation of molecular hydrogen to protons .

Cupriavidus necator is a gram-negative, facultatively chemolithoautotrophic bacterium that can utilize hydrogen as an energy source. The bacterium's ability to grow on hydrogen depends critically on its hydrogenase enzymes, among which the membrane-bound hydrogenase (MBH) is particularly important. The MBH complex consists of three major subunits: the large subunit HoxG containing the Ni-Fe active site, the small subunit HoxK containing iron-sulfur clusters, and the membrane-integral cytochrome b subunit HoxZ .

The recombinant form of the hoxZ protein has been produced to facilitate structural and functional studies of this important enzyme component. By expressing the protein in heterologous systems like Escherichia coli with affinity tags (typically histidine tags), researchers have been able to purify and characterize this protein more effectively .

Biochemical Classification and Basic Properties

HoxZ is classified as a b-type cytochrome protein with a molecular weight of approximately 27.581 kDa, derived from its 244-amino acid sequence . The protein is encoded by the hoxZ gene, also known by the ordered locus name PHG003 in the Cupriavidus necator genome .

PropertyDescription
Protein NameProbable Ni/Fe-hydrogenase B-type cytochrome subunit
Gene NamehoxZ
SynonymsPHG003
UniProt IDP31898
Length244 amino acids
Molecular Weight27.581 kDa
Typeb-type cytochrome
FunctionMembrane anchor and electron transport

Tertiary Structure and Membrane Integration

HoxZ functions as a membrane-integral cytochrome with specific regions embedded within the lipid bilayer. The protein contains transmembrane domains that anchor the entire hydrogenase complex to the membrane. The integration of HoxZ into the membrane is facilitated by specific lipids, particularly phosphatidylethanolamine and phosphatidylglycerol, which play crucial roles in mediating the interaction between HoxZ and the hydrogenase module composed of HoxG and HoxK .

The heme centers within the HoxZ protein are strategically positioned to accept electrons from the iron-sulfur clusters of the HoxK subunit and transfer them to the quinone pool of the respiratory chain . This arrangement enables efficient electron transfer from hydrogen oxidation to cellular respiration.

Composition of the [NiFe]-Hydrogenase Complex

The membrane-bound [NiFe]-hydrogenase complex in Cupriavidus necator consists of three subunits with distinct functions:

SubunitProtein NameFunctionMolecular Weight
HoxGLarge subunitContains the [NiFe] active site for H₂ catalysis67.1 kDa
HoxKSmall subunitContains three Fe-S clusters for electron relay34.6 kDa
HoxZCytochrome bMembrane anchor and electron transfer27.58 kDa

The complete functional unit is represented as [HoxZ][HoxK][HoxG], with HoxG and HoxK forming what is termed the "hydrogenase module," which is oriented toward the periplasmic space .

Dual Function of HoxZ

HoxZ serves two critical functions within the hydrogenase complex:

  1. Membrane Anchoring: HoxZ anchors the entire hydrogenase complex to the cytoplasmic membrane, positioning the catalytic components appropriately for interaction with substrates and electron carriers .

  2. Electron Transfer: As a b-type cytochrome, HoxZ contains heme groups that accept electrons from the iron-sulfur clusters in HoxK and transfer them to the quinone pool of the respiratory chain. This completes the electron transport pathway from hydrogen oxidation to cellular energy generation .

Research has demonstrated that when hydrogen is oxidized at the [NiFe] active site in HoxG, the released electrons are transferred through the Fe-S cluster relay in HoxK to the heme centers in HoxZ, and ultimately to the respiratory chain. This electron transfer pathway is essential for the bacterium's ability to utilize hydrogen as an energy source .

Oxygen Tolerance and Complex Formation

A notable feature of the Cupriavidus necator hydrogenase complex is its oxygen tolerance, allowing it to function even in the presence of oxygen, which typically inhibits hydrogenase activity. This oxygen tolerance involves not only the catalytic reaction but also the biosynthesis of the complex redox cofactors .

Recent research suggests that the MBH exists in the membrane as a high molecular mass complex consisting of three heterotrimeric units, rather than as individual trimers. This structural arrangement may contribute to the complex's stability and oxygen tolerance .

Expression Systems

For research and commercial purposes, the hoxZ protein is commonly expressed as a recombinant protein in heterologous systems, primarily Escherichia coli. The gene encoding the hoxZ protein is cloned into appropriate expression vectors, often with the addition of affinity tags to facilitate purification .

The most common recombinant form is the His-tagged version, where a string of histidine residues is fused to either the N-terminus or C-terminus of the protein. This tag allows for purification using metal affinity chromatography, streamlining the isolation process .

Isolation of the Native Heterotrimeric Complex

This breakthrough has allowed researchers to demonstrate that the hydrogenase module is productively connected to the cytochrome b, as evidenced by H₂-dependent reduction of the two HoxZ-stemming heme centers. Further investigation has revealed that the MBH exists in the membrane as a high molecular mass complex consisting of three heterotrimeric units .

Role of Lipids in Complex Stability

Research has identified specific lipids, particularly phosphatidylethanolamine and phosphatidylglycerol, as playing crucial roles in the interaction between the hydrogenase module and the cytochrome b subunit. These findings highlight the importance of the membrane environment for the proper assembly and function of the hydrogenase complex .

Maturation and Oxygen Tolerance

The maturation of the MBH complex involves several accessory proteins, including HoxR and HoxT, which are key components in MBH maturation at ambient oxygen levels. These proteins contribute to the oxygen tolerance of the MBH by facilitating proper cofactor assembly and stability under aerobic conditions .

Studies have shown that mutations in the genes encoding these maturation factors can inhibit or retard MBH-driven growth on hydrogen at high oxygen partial pressures, underscoring their importance for the functioning of the complete hydrogenase complex, including the HoxZ component .

Biotechnological Applications

The oxygen-tolerant nature of the Cupriavidus necator MBH complex, including the HoxZ component, makes it particularly interesting for biotechnological applications. The ability to function in the presence of oxygen is a valuable property for potential applications in biofuel cells, biohydrogen production, and other renewable energy technologies .

Recombinant forms of the hoxZ protein, such as those available commercially, provide valuable tools for studying the structure-function relationships of this important enzyme component. These studies contribute to our understanding of hydrogen metabolism and may lead to the development of improved biocatalysts for sustainable energy applications .

Research Tools

Recombinant hoxZ proteins are used in various research applications, including:

  1. Structural studies to elucidate the three-dimensional organization of the protein and its interaction with other components of the hydrogenase complex

  2. Functional assays to investigate electron transfer mechanisms and oxygen tolerance

  3. Development of biomimetic catalysts inspired by the natural hydrogenase system

  4. Educational and training purposes in biochemistry and molecular biology laboratories

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to concentrate the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We strive to develop the specified tag if you have specific tag type requirements. Please inform us during order placement.
Synonyms
hoxZ; PHG003; Probable Ni/Fe-hydrogenase B-type cytochrome subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-244
Protein Length
full length protein
Species
Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) (Ralstonia eutropha)
Target Names
hoxZ
Target Protein Sequence
MSTKMQADRIADATGTDEGAVASGKSIKATYVYEAPVRLWHWVNALAIVVLAVTGFFIGS PPATRPGEASANFLMGYIRFAHFVAAYIFAIGMLGRIYWATAGNHHSRELFSVPVFTRAY WQEVISMLRWYAFLSARPSRYVGHNPLARFAMFFIFFLSSVFMILTGFAMYGEGAQMGSW QERMFGWVIPLLGQSQDVHTWHHLGMWFIVVFVIVHVYAAIREDIMGRQSVVSTMVSGYR TFKD
Uniprot No.

Target Background

Function
This protein is a probable b-type cytochrome.
Database Links

KEGG: reh:PHG003

Protein Families
HupC/HyaC/HydC family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the hoxZ protein and what is its basic structure?

The hoxZ protein is a B-type cytochrome subunit that functions as part of the membrane-bound hydrogenase (MBH) complex in hydrogen-metabolizing bacteria like Cupriavidus necator (formerly known as Alcaligenes eutrophus). Structurally, it is a dihaem cytochrome b containing two heme groups with midpoint potentials (Em7.0) of +10 mV and +166 mV at pH 7.0 . The full-length protein consists of 244 amino acids with a predicted membrane-spanning topology. The amino acid sequence includes characteristic motifs for heme binding and membrane integration . The protein's structure allows it to function as an electron transfer component within the hydrogen oxidation pathway.

What are the primary functional roles of hoxZ in bacterial hydrogen metabolism?

Based on research with Cupriavidus necator and related organisms like Azotobacter vinelandii, hoxZ performs several essential functions in hydrogen metabolism:

  • Membrane anchoring: It serves as a critical anchor that attaches the hydrogenase complex to the periplasmic side of the cell membrane .

  • Electron transfer: It functions as the link necessary for transferring electrons from hydrogen to the ubiquinone pool in the respiratory chain .

  • Enzyme activation: Evidence suggests it plays a role in activating and maintaining the hydrogenase in a reduced active state .

  • H₂-coupled respiration: It is essential for hydrogen-dependent respiratory processes .

Deletion studies have demonstrated that strains lacking functional hoxZ exhibit significantly reduced rates of H₂ oxidation when using O₂ as the electron acceptor, confirming its importance in the electron transport pathway .

How is recombinant hoxZ typically produced for research purposes?

Recombinant hoxZ is typically produced in E. coli expression systems. The full-length Cupriavidus necator hoxZ gene (encoding amino acids 1-244) is cloned into an expression vector with an N-terminal His-tag for purification purposes . After expression, the protein is purified using affinity chromatography, taking advantage of the His-tag's affinity for metal ions. The purified protein is often provided in lyophilized form with greater than 90% purity as determined by SDS-PAGE .

For reconstitution, the lyophilized protein should be dissolved in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, glycerol (typically 5-50% final concentration) should be added before aliquoting and storing at -20°C/-80°C to prevent protein degradation during freeze-thaw cycles .

What are the most effective methods for assessing hoxZ activity in hydrogenase complexes?

Several complementary methods have proven effective for assessing hoxZ activity within hydrogenase complexes:

  • Viologen-based spectrophotometric assays: Benzyl viologen (BV) or methylene blue can be used as artificial electron acceptors to measure H₂ oxidation activity. These dyes change color when reduced, allowing for quantitative assessment of electron transfer rates .

  • Blue Native PAGE (BN-PAGE) with activity staining: This technique allows for separation of intact protein complexes while preserving their native interactions, followed by in-gel activity detection using hydrogen as an electron donor and methylviologen (MV) or benzyl viologen (BV) as electron acceptors that produce visible bands upon reduction .

  • Oxygen consumption measurements: Since hoxZ is involved in H₂-dependent respiration, oxygen electrode measurements can assess the functional coupling between hydrogen oxidation and oxygen reduction .

  • Protein film electrochemistry: While not mentioned directly for hoxZ in the provided materials, this technique has been used to study hydrogenase reactivation kinetics and is useful for characterizing electron transfer properties .

When comparing wild-type and hoxZ-deficient strains, it's important to note that hoxZ deletion affects H₂ oxidation with O₂ as the electron acceptor, but when artificial electron acceptors like methylene blue are used directly with hydrogenase, comparable rates may be observed between wild-type and mutant strains .

How can researchers effectively study the oxygen sensitivity of hoxZ-containing hydrogenase complexes?

Oxygen sensitivity is a critical characteristic of [NiFe] hydrogenases that impacts their biotechnological applications. To effectively study oxygen sensitivity of hoxZ-containing complexes, researchers can employ these methodological approaches:

  • Activity recovery assays: Expose samples to oxygen, then measure the recovery of hydrogen oxidation activity under anoxic conditions over time. This approach can reveal the reactivation kinetics and the influence of various factors (like reduced glutathione) on reactivation .

  • Redox buffer effects analysis: Using different concentrations of reducing agents such as glutathione (GSH), L-cysteine, or DTT to test their effects on hydrogenase reactivation after oxygen exposure. GSH has been shown to enhance reactivation in a concentration-dependent manner .

  • Complexome analysis: Combining Blue Native PAGE with mass spectrometry can reveal how oxygen exposure affects the integrity of the hydrogenase complex and the formation of subcomplexes under different conditions .

  • Spectroscopic techniques: FTIR (Fourier-transform infrared) spectroscopy can detect different redox states of the [NiFe] active site (Ni-B-like, Ni-SI, Ni-C, and Ni-R states) after oxygen exposure .

The data suggest that reduced glutathione (GSH) plays a crucial role in modulating hydrogenase activity, particularly for reactivation after oxygen exposure, while oxidized glutathione (GSSG) negatively affects activity and oxygen insensitivity .

What expression systems and purification strategies yield the most active recombinant hoxZ protein?

While the search results don't provide a direct comparison of expression systems for hoxZ, the available information suggests the following approach for obtaining functionally active recombinant hoxZ:

Expression system: E. coli appears to be the preferred heterologous host for recombinant hoxZ expression . When expressing membrane proteins like hoxZ, specialized E. coli strains designed for membrane protein expression may improve yields.

Purification strategy:

  • Affinity chromatography using His-tagged protein (N-terminal His-tag appears common)

  • Buffer optimization containing components that stabilize membrane proteins

  • Quality assessment by SDS-PAGE (>90% purity is achievable)

Storage recommendations:

  • Store lyophilized protein at -20°C/-80°C

  • After reconstitution in deionized sterile water (0.1-1.0 mg/mL), add glycerol to 5-50% final concentration

  • Avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

To maximize activity, care should be taken to maintain reducing conditions during purification and storage, as oxidation can affect the heme centers that are critical for electron transfer function.

How does the hoxZ subunit contribute to electron transfer pathways in different hydrogenase systems?

The hoxZ subunit plays a sophisticated role in hydrogen-dependent electron transfer across different bacterial systems:

In Cupriavidus necator (formerly Alcaligenes eutrophus), hoxZ functions as a dihaem cytochrome b with two hemes having distinct midpoint potentials (+10 mV and +166 mV) . This arrangement suggests a directed electron transfer pathway where electrons move from the hydrogenase catalytic site through the lower potential heme first, then to the higher potential heme, and finally to the ubiquinone pool.

The membrane-bound hydrogenase (MBH) complex requires hoxZ for:

  • Efficient electron transfer from H₂ to the respiratory chain

  • Proper anchoring to the membrane

  • H₂-coupled respiration

Experiments with Azotobacter vinelandii showed that hoxZ deletion mutants maintained hydrogenase activity with artificial electron acceptors (methylene blue) but exhibited diminished activity with natural electron acceptors (O₂), highlighting its role in the native electron transport chain .

Interestingly, while hoxZ is essential for H₂-coupled respiration, it does not affect electron transport activities linked to other substrates like succinate and NADH, suggesting specificity in its electron transfer role . The cytochrome b subunit appears to be conserved across diverse hydrogenase systems, indicating its evolutionary importance in hydrogen metabolism.

What mechanisms govern the oxygen sensitivity and reactivation of hoxZ-containing hydrogenase complexes?

The mechanisms governing oxygen sensitivity and reactivation of hoxZ-containing hydrogenase complexes involve complex redox processes that are still being elucidated:

  • Oxidative inactivation: Oxygen exposure leads to the formation of inactive states in the [NiFe] active site of hydrogenases. Recent research with the Hox hydrogenase from Synechocystis (which contains components analogous to hoxZ) shows that oxygen affects complex integrity, leading to the formation of various subcomplexes .

  • Reactivation pathways: Reactivation after oxygen exposure is redox-dependent and can follow multiple pathways:

    • Low potential reactivation pathway (below -563 mV)

    • Higher potential reactivation pathway (between -200 and -100 mV)

  • Redox buffer effects: Glutathione (GSH) plays a significant role in modulating hydrogenase activity, particularly in:

    • Enhancing maximal hydrogenase activity

    • Stabilizing long-term activity

    • Promoting reactivation after oxygen exposure in a concentration-dependent manner

  • Structural integrity: Oxygen exposure affects the integrity of the hydrogenase complex, as revealed by Blue Native PAGE and mass spectrometry analyses. GSH treatment helps maintain complex stability under oxidative conditions .

The research suggests that the classification of hydrogenases as simply "oxygen-sensitive" or "oxygen-insensitive" is insufficient, as the response to oxygen is modulated by the cellular redox environment, particularly the GSH/GSSG ratio .

How do the properties of hoxZ differ between Cupriavidus necator and other hydrogen-metabolizing bacteria?

The hoxZ protein and its homologs show both conserved features and species-specific adaptations across different hydrogen-metabolizing bacteria:

Cupriavidus necator (formerly Alcaligenes eutrophus):

  • Contains a dihaem cytochrome b with distinct redox potentials (+10 mV and +166 mV)

  • Essential for anchoring the MBH complex to the membrane

  • Required for H₂-coupled respiration and electron transfer to the ubiquinone pool

Azotobacter vinelandii:

  • The hoxZ gene is located immediately downstream of the hydrogenase genes (hoxKG)

  • Deletion affects H₂ oxidation with O₂ as electron acceptor but not with artificial electron acceptors

  • Plays a role in activating and maintaining hydrogenase in a reduced active state

Synechocystis sp.:

  • While not directly named hoxZ in the search results, this cyanobacterium contains a bidirectional [NiFe] Hox hydrogenase complex that operates as a dimerized heteropentamer, Hox(HYEUF)₂

  • Shows moderate oxygen tolerance, retaining 25-50% of its H₂ forming activity in 1% oxygen

  • Exhibits rapid reactivation (1-2 minutes) after oxygen exposure under anoxic conditions

These differences suggest evolutionary adaptations to different ecological niches and metabolic requirements. The cyanobacterial system appears to have developed mechanisms for more rapid reactivation, likely due to the oxygen-producing photosynthetic lifestyle of these organisms.

What are the most promising approaches for enhancing the oxygen tolerance of hoxZ-containing hydrogenase systems?

Based on current research, several promising approaches could enhance oxygen tolerance of hoxZ-containing hydrogenase systems:

  • Redox buffer engineering: The significant positive effect of glutathione (GSH) on hydrogenase reactivation after oxygen exposure suggests that optimizing cellular redox buffers could enhance oxygen tolerance. Increasing intracellular GSH concentrations or maintaining a favorable GSH/GSSG ratio could be achieved through:

    • Overexpression of glutathione biosynthesis genes

    • Engineering redox-responsive regulatory systems

    • Supplementation with exogenous thiols in biotechnological applications

  • Protein engineering: Targeted modifications of hoxZ and associated hydrogenase components based on insights from naturally oxygen-tolerant hydrogenases could improve performance:

    • Introduction of additional cysteine residues to create protective disulfide bridges

    • Modification of the electron transfer pathway to minimize oxygen accessibility

    • Engineering narrower gas channels that preferentially allow hydrogen but restrict oxygen access

  • Complexome optimization: Since oxygen affects hydrogenase complex integrity, strategies to stabilize the native complex structure could enhance oxygen tolerance:

    • Co-expression of stabilizing accessory proteins

    • Introduction of engineered protein-protein interfaces

    • Modification of membrane anchoring domains for enhanced stability

  • Combined approaches: The most successful strategies will likely involve multiple complementary approaches to address the multifaceted nature of oxygen sensitivity in [NiFe] hydrogenases.

Future research should focus on understanding the precise mechanisms of how GSH enhances hydrogenase stability and activity, which could lead to more targeted approaches for oxygen tolerance enhancement.

How can researchers effectively study the interaction between hoxZ and other components of the hydrogenase complex?

Studying the interactions between hoxZ and other hydrogenase complex components requires specialized techniques for membrane protein complexes:

  • Blue Native PAGE coupled with mass spectrometry (complexome analysis): This approach has successfully revealed how oxygen exposure affects the integrity of hydrogenase complexes and the formation of subcomplexes under different conditions. By maintaining native protein-protein interactions during separation, researchers can identify stable subcomplexes and their components .

  • Crosslinking coupled with mass spectrometry: Chemical crosslinking can capture transient or weak interactions between hoxZ and other subunits before analysis by mass spectrometry to identify interaction sites.

  • Co-immunoprecipitation with tagged components: Using antibodies against hoxZ or other hydrogenase components to pull down the entire complex for subsequent analysis of interacting partners.

  • In-gel activity assays: After BN-PAGE separation, activity staining with hydrogen as electron donor and viologen dyes as electron acceptors can reveal which complexes maintain catalytic activity, providing insights into functional interactions .

  • Mutational analysis with activity measurements: Systematic mutation of potential interaction sites followed by activity measurements can identify residues critical for complex formation and electron transfer.

  • Structural biology approaches: When feasible, cryo-electron microscopy of membrane protein complexes can provide direct visualization of the spatial arrangement of hoxZ relative to other components.

The search results indicate that these approaches have revealed that the hoxZ product is essential for anchoring the MBH complex to the periplasmic side of the membrane and that oxygen exposure affects the integrity of hydrogenase complexes, causing the formation of various subcomplexes under different conditions .

What insights can comparative studies of hoxZ across different bacterial species provide for biotechnological applications?

Comparative studies of hoxZ across bacterial species can yield valuable insights for biotechnological applications, particularly in hydrogen production and utilization systems:

This comparative approach moves beyond the binary classification of hydrogenases as simply "oxygen-sensitive" or "oxygen-insensitive" toward a more nuanced understanding of the diverse mechanisms that hydrogen-metabolizing bacteria have evolved .

What are the critical factors to consider when designing experiments to study hoxZ function in hydrogenase complexes?

When designing experiments to study hoxZ function in hydrogenase complexes, researchers should consider these critical factors:

  • Maintenance of reducing conditions: The oxidation state of hoxZ significantly affects its activity. Experimental buffers should contain appropriate reducing agents (e.g., DTT, GSH) to maintain hoxZ in its active state. Consider testing multiple concentrations of reducing agents as GSH has shown concentration-dependent effects on hydrogenase activity .

  • Oxygen control: Given the oxygen sensitivity of hydrogenases, experiments should be conducted under carefully controlled atmospheric conditions. Use anaerobic chambers or sealed reaction vessels with defined gas compositions. When studying oxygen effects, precisely control exposure time and concentration .

  • Complex integrity preservation: The native interactions between hoxZ and other hydrogenase components are essential for proper function. Use gentle extraction methods and native-preserving techniques like Blue Native PAGE rather than denaturing conditions when studying the intact complex .

  • Selection of appropriate electron acceptors/donors: The choice of electron acceptors significantly affects observed activities. Natural (ubiquinone) versus artificial (viologens, methylene blue) electron acceptors can yield different results, especially in mutant studies .

  • pH and temperature optimization: The optimal conditions for hoxZ function may vary between species and experimental setups. A systematic exploration of pH and temperature effects should be conducted to identify optimal conditions.

  • Time-resolved measurements: Given the dynamic nature of hydrogenase activation/deactivation, time-course experiments are essential to capture the full kinetic profile of activity changes, especially during reactivation studies .

  • Appropriate controls: Include controls for non-specific electron transfer and spontaneous reactions, especially when using artificial electron acceptors that may have background reduction rates.

How can researchers distinguish between effects on hoxZ itself versus effects on the entire hydrogenase complex?

Distinguishing between effects specific to hoxZ versus those affecting the entire hydrogenase complex requires careful experimental design:

What are the most effective methods for analyzing the redox properties of hoxZ in relation to hydrogenase activity?

To effectively analyze the redox properties of hoxZ in relation to hydrogenase activity, researchers can employ these specialized methods:

The data from these techniques can be integrated to develop a comprehensive model of how electrons flow through hoxZ and how this electron transfer is affected by environmental conditions like oxygen exposure or the presence of reducing agents like glutathione .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.