Recombinant Cupriavidus necator Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Introduction to Prolipoprotein Diacylglyceryl Transferase (Lgt)

Prolipoprotein diacylglyceryl transferase (Lgt) is a membrane-bound enzyme critical for bacterial lipoprotein biosynthesis. Lgt catalyzes the transfer of an sn-1,2-diacylglyceryl group from phosphatidylglycerol to the thiol group of a conserved cysteine residue in prolipoproteins, forming a thioether bond. This modification anchors lipoproteins to membranes and is essential for their function in nutrient uptake, cell envelope integrity, and virulence .

While Lgt is well-characterized in Escherichia coli , its role in Cupriavidus necator—a versatile chemolithoautotroph used in biotechnology—remains less explored. Recombinant Lgt from C. necator refers to the enzyme produced via genetic engineering, often in heterologous hosts, to study its structure, function, or industrial applications.

Biochemical Function and Mechanism

Lgt operates within a three-step lipoprotein maturation pathway:

  1. Diacylglyceryl transfer by Lgt.

  2. Signal peptide cleavage by signal peptidase II (Lsp).

  3. N-acylation by apolipoprotein N-acyltransferase (Lnt) .

In C. necator, lipoproteins likely play roles in:

  • Hydrogenase and formate dehydrogenase assembly .

  • Substrate transport across membranes .

  • Stress response during autotrophic growth .

Key reaction catalyzed by Lgt:

Phosphatidylglycerol+ProlipoproteinDiacylglyceryl-prolipoprotein+Glycerolphosphate\text{Phosphatidylglycerol} + \text{Prolipoprotein} \rightarrow \text{Diacylglyceryl-prolipoprotein} + \text{Glycerolphosphate}

This reaction is oxygen-tolerant and occurs on the outer leaflet of the inner membrane .

Gene Organization

  • C. necator’s genome encodes multiple hydrogenases and formate dehydrogenases with lipoprotein subunits requiring Lgt-mediated modification .

  • Homologs of E. coli Lgt are present in C. necator’s chromosome 1, which houses constitutive metabolic genes .

Cloning and Expression

Recombinant Lgt from C. necator could be produced using modular plasmid systems like the pMTL70000 series, optimized for C. necator . Key steps include:

  1. Amplification of lgt from C. necator H16 genomic DNA.

  2. Cloning into vectors with Cupriavidus-compatible replicons (e.g., pBBR1 or RK2 origin).

  3. Expression in E. coli or C. necator hosts under inducible promoters .

Industrial Relevance

  • Biofuel production: Lipoproteins facilitate electron transport in hydrogenases , critical for C. necator’s autotrophic growth on H₂/CO₂ .

  • Polyhydroxyalkanoate (PHA) biosynthesis: Enhanced lipoprotein function may improve substrate uptake during heterotrophic PHA production .

Research Challenges and Future Directions

Table 1: Comparative Analysis of Lgt in E. coli vs. C. necator

FeatureE. coli Lgt C. necator Lgt (Inferred)
EssentialityEssential for growthLikely essential (based on )
Membrane localizationInner membraneInner membrane
Substrate specificityConserved -L-X-X-C motifSimilar motif expected
CofactorsPhosphatidylglycerol-dependentPhosphatidylglycerol-dependent

Open questions:

  • How does C. necator Lgt interact with duplicated hydrogenase operons ?

  • Can recombinant Lgt improve yields of membrane-bound enzymes in industrial strains ?

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
It is recommended to briefly centrifuge the vial prior to opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life of the product is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
lgt; H16_A2985; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-272
Protein Length
full length protein
Species
Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) (Ralstonia eutropha)
Target Names
lgt
Target Protein Sequence
MLIHPQFDPVAIHLGPLAIRWYGLMYLAGFIMFLGFGRLRIRQPHIAAKGWTTRDLDDML FFGVLGVILGGRLGYVLFYKPSYYLAHPLEILKVWEGGMAFHGGFLGVVVAMWLFGKLRR RHWMEVTDFIAPMIPCGLAAGRIGNFINGELWGRATDLPWGMIFPQAGDNIPRHPSQLYQ FAGEGVALFIVLWLFARKPRPMGAVSGVFLIGYGAFRFAAEFAREPDNFLGLLALKLSMG QWLSLPMILAGIAMVVWAYRRQPGAGASQPVA
Uniprot No.

Target Background

Function
Prolipoprotein diacylglyceryl transferase (Lgt) from *Cupriavidus necator* catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Cupriavidus necator and why is it important for recombinant protein research?

Cupriavidus necator (formerly known as Ralstonia eutropha) is a gram-negative bacterium with unique metabolic capabilities, allowing it to grow under heterotrophic, autotrophic, and mixotrophic conditions. This metabolic flexibility makes it valuable for various biotechnological applications, including recombinant protein production and polyhydroxyalkanoate (PHA) synthesis. The organism can rapidly switch between different growth modes, making it adaptable to different substrate conditions and potentially useful for sustainable bioproduction systems . Additionally, C. necator can be genetically engineered to express various recombinant proteins, including enzymes like prolipoprotein diacylglyceryl transferase, using established molecular biology techniques similar to those used in reporter systems .

What is the function of prolipoprotein diacylglyceryl transferase (lgt) in bacterial systems?

Prolipoprotein diacylglyceryl transferase (Lgt) is an integral membrane enzyme that catalyzes the first reaction in the three-step post-translational lipid modification pathway of bacterial lipoproteins. Specifically, Lgt transfers a diacylglyceryl moiety from phosphatidylglycerol to a cysteine residue in the conserved "lipobox" motif of prolipoproteins . This modification is essential for bacterial survival, particularly in Gram-negative bacteria where deletion of the lgt gene is often lethal. The lipid modification anchors various functional proteins to the bacterial membrane, enabling them to participate in critical processes including maintenance of cell envelope architecture, nutrient uptake, transport, and virulence mechanisms .

How does the growth condition affect gene expression in C. necator?

For heterotrophic growth, the substrate type affects adaptation time:

  • With acetate: Short lag phase (<12 hours) at low concentrations

  • With glucose or glycerol: Consistently longer lag phase (>12 hours)

  • With high acetate concentrations: Increased lag phase

The expression of various genes can be regulated by specific promoters, as demonstrated in recombinant reporter systems. For example, the PSH promoter (soluble hydrogenase promoter) shows differential activity depending on growth conditions - being repressed in fructose media (FN) but de-repressed in glycerol media (GN) . These substrate-specific responses must be considered when designing expression systems for recombinant proteins in C. necator.

What are the optimal conditions for expressing recombinant proteins in C. necator?

For optimal expression of recombinant proteins in C. necator, researchers should consider the following methodological approaches:

Growth Medium and Conditions:

  • Temperature: 30°C is typically optimal

  • pH: Maintain between 6.8-7.2

  • Carbon source: Selection depends on desired expression profile

    • For constitutive expression: Fructose-based minimal media

    • For inducible systems using PSH promoter: Glycerol-based media for de-repression

  • Oxygen levels: Maintain below 0.7 atm partial pressure to avoid growth inhibition

Expression System Considerations:

  • Promoter selection is critical for recombinant protein expression

  • The PSH promoter can be used for conditional expression systems

  • Integration into the megaplasmid pHG1 has been demonstrated successfully for stable expression

  • Suicide vectors like pJQ200mp18 can facilitate genomic integration through homologous recombination

Induction Parameters:

  • For PSH promoter-controlled expression: Transition to glycerol-based media induces expression

  • Monitoring using reporter proteins (e.g., GFP) can verify successful induction

  • Optimal harvest timing typically corresponds to late exponential growth phase

The creation of recombinant C. necator strains with enhanced capabilities has been demonstrated, as in the case of lipase-expressing strains with improved ability to utilize fatty substrates .

How can I design an effective vector system for lgt expression in C. necator?

Designing an effective vector system for lgt expression in C. necator requires careful consideration of several factors:

Vector Components:

  • Origin of replication: Compatible with C. necator replication machinery

  • Selection marker: Typically antibiotic resistance genes effective in C. necator (kanamycin or gentamicin resistance)

  • Promoter: Select based on desired expression profile

    • Constitutive: Strong promoters like Pj5

    • Inducible: PSH promoter (responds to metabolic conditions)

  • Ribosome binding site (RBS): Optimize for C. necator translation efficiency

  • Multiple cloning site (MCS): For convenient insertion of the lgt gene

  • Terminator: Efficient transcription termination sequence

Cloning Strategy:

  • PCR amplification of the lgt gene with appropriate restriction sites

  • Digestion and ligation into the expression vector

  • Transformation into E. coli for plasmid propagation

  • Sequence verification

  • Transfer to C. necator via conjugation, electroporation, or biparental mating

Integration Approach:
For stable expression, genomic integration is recommended:

  • Create a suicide vector containing:

    • Upstream homologous region (500-1000 bp)

    • Promoter-lgt construct

    • Downstream homologous region (500-1000 bp)

  • Transform into an E. coli donor strain (e.g., S17-1)

  • Perform conjugation with C. necator

  • Select for positive integration events

  • Confirm integration by PCR

This approach is similar to the methodology used for creating the PSH-gfp reporter strain described in the literature .

What expression verification methods are most effective for recombinant lgt in C. necator?

Multiple complementary approaches should be employed to verify successful expression of recombinant lgt in C. necator:

Molecular Verification:

  • RT-PCR/qRT-PCR: Quantify lgt mRNA levels

    • Design primers specific to the recombinant lgt sequence

    • Compare expression levels under different conditions

    • Include appropriate housekeeping genes as controls

  • Western blotting: Confirm protein production

    • Engineer epitope tags (His, FLAG) if antibodies against Lgt are unavailable

    • Use membrane protein extraction protocols optimized for integral membrane proteins

  • PCR verification: Confirm genomic integration

    • Design primers spanning the integration junction sites

Functional Verification:

  • Enzymatic activity assays: Measure diacylglyceryl transferase activity

    • Monitor transfer of radiolabeled or fluorescently labeled phospholipids to peptide substrates

    • Compare activity to wild-type levels or other bacterial Lgt proteins

  • Complementation studies: Test functionality

    • Attempt complementation of lgt-knockout cells with the recombinant construct

    • Essential residues like Arg143 and Arg239 (based on E. coli Lgt) should be conserved for functionality

Visualization:

  • GFP fusion reporter: If applicable

    • Create C-terminal GFP fusion to monitor expression and localization

    • Use fluorescence microscopy and flow cytometry to quantify expression

  • Membrane fraction analysis: Confirm proper localization

    • Fractionate cells to isolate membrane components

    • Verify Lgt presence in appropriate membrane fraction

Example Verification Workflow:

  • Confirm genomic integration by PCR

  • Verify transcription by RT-PCR

  • Confirm translation by Western blot

  • Validate functionality through enzymatic assays

  • Assess cellular localization by fractionation studies

How can I establish a reliable activity assay for recombinant lgt from C. necator?

Establishing a reliable activity assay for recombinant Lgt from C. necator requires careful consideration of the enzyme's membrane-associated nature and specific catalytic requirements:

Assay Components:

  • Substrate preparation:

    • Phosphatidylglycerol (PG) as lipid donor

    • Synthetic peptide containing lipobox consensus sequence (typically LXXC) as acceptor

    • Consider fluorescently labeled or radiolabeled substrates for detection sensitivity

  • Reaction conditions:

    • Buffer composition: Typically Tris-HCl or phosphate buffer (pH 7.0-8.0)

    • Divalent cations: Mg²⁺ or Mn²⁺ (typically 1-5 mM)

    • Detergent: Critical for solubilizing membrane proteins while maintaining activity (e.g., DDM at 0.01-0.1%)

    • Temperature: 30°C (optimal for C. necator enzymes)

Detection Methods:

  • Direct product detection:

    • HPLC separation of reaction products

    • Mass spectrometry to detect modified peptides

    • TLC analysis of lipid transfer

  • Coupled enzyme assays:

    • Monitor release of byproducts from the reaction

    • Use secondary enzymes to produce measurable signals

Controls and Validation:

  • Positive control: Use purified Lgt from E. coli or other well-characterized species

  • Negative controls:

    • Heat-inactivated enzyme

    • Reaction without peptide substrate

    • Reaction without PG substrate

  • Inhibition studies:

    • Use palmitic acid as a known inhibitor to validate assay specificity

    • Test inhibition by varying O₂ levels, which is known to affect C. necator metabolism

Data Analysis:

  • Determine kinetic parameters (Km, Vmax) for both substrates

  • Compare activity across different growth conditions

  • Assess the effects of mutations in critical residues (e.g., Arg143, Arg239) based on homology to E. coli Lgt

What structural features are essential for lgt function and how can they be identified in C. necator?

Based on structural studies of E. coli Lgt, several essential features can be identified and investigated in C. necator Lgt:

Key Structural Elements:

  • Transmembrane domains: Lgt typically contains multiple transmembrane helices forming a membrane-embedded core

  • Substrate binding sites:

    • Phosphatidylglycerol binding pocket

    • Peptide/lipobox recognition site

  • Catalytic residues: Critical for the transferase reaction

  • Lateral access channels: Allow substrate entry and product exit within the membrane plane

Methods for Structural Analysis:

  • Sequence alignment and homology modeling:

    • Align C. necator Lgt with E. coli Lgt and other characterized homologs

    • Identify conserved regions likely to be functionally important

    • Build homology models based on available crystal structures

  • Mutagenesis studies:

    • Target conserved residues (particularly Arg143 and Arg239 equivalents)

    • Generate single point mutations using site-directed mutagenesis

    • Evaluate effects on enzyme activity and substrate binding

    • Complementation tests in lgt-knockout cells can identify essential residues

  • Protein-substrate interaction analysis:

    • Cross-linking studies with substrate analogs

    • Fluorescence-based binding assays

    • Hydrogen-deuterium exchange mass spectrometry to identify binding interfaces

Predicted Essential Features in C. necator Lgt:
Based on homology to E. coli Lgt, the following features are likely critical:

  • Conserved arginine residues (equivalents to Arg143 and Arg239) for phospholipid binding

  • H-P-Y-S-G motif involved in catalysis

  • Transmembrane helical arrangement forming a lateral opening mechanism

  • Hydrophobic residues lining the substrate binding pocket

How does the metabolic state of C. necator affect lgt activity and lipoprotein processing?

The metabolic state of C. necator significantly influences cellular processes, potentially including Lgt activity and lipoprotein processing:

Metabolic Conditions and Their Effects:

Metabolic StateGrowth SubstrateLag PhasePotential Impact on Lgt Activity
AutotrophicH₂/O₂/CO₂ (7:2:1)Short (<12h)Likely optimal under balanced conditions
Autotrophic (high O₂)O₂ >0.7 atmExtended (>22h)Potential inhibition due to oxidative stress
HeterotrophicAcetate (low conc.)Short (<12h)Favorable for membrane protein function
HeterotrophicGlucose/glycerolLong (>12h)May alter membrane composition affecting Lgt
MixotrophicCombined substratesVariableComplex regulatory effects possible

Regulatory Mechanisms:

  • Transcriptional regulation:

    • Different carbon sources may alter lgt gene expression

    • Promoter activity varies with metabolic state, as seen with the PSH promoter

  • Post-translational modifications:

    • Redox state changes under different growth conditions may affect protein activity

    • Membrane composition differs between autotrophic and heterotrophic growth, potentially affecting integral membrane protein function

  • Substrate availability:

    • Phospholipid composition varies with growth conditions

    • Availability of phosphatidylglycerol (PG) may change under different metabolic states

Methodological Approaches to Study These Effects:

  • Comparative enzyme activity:

    • Measure Lgt activity in membrane preparations from cells grown under different conditions

    • Normalize to enzyme concentration using quantitative Western blotting

  • Lipidomic analysis:

    • Characterize membrane phospholipid composition under different growth conditions

    • Correlate PG availability with Lgt activity

  • Proteomics approach:

    • Quantify lipoprotein processing efficiency under different metabolic states

    • Identify lipoproteins with altered modification patterns

  • Reporter systems:

    • Develop GFP-based reporters for monitoring lgt expression under different conditions

    • Use fluorescence assays similar to those employed for the PSH promoter studies

What are the most promising applications of recombinant C. necator lgt in biosynthetic pathways?

Recombinant C. necator Lgt holds significant potential for various biosynthetic applications due to the organism's metabolic versatility and the critical role of lipoproteins in cellular processes:

Lipoprotein Engineering Applications:

  • Biocatalyst anchoring:

    • Lipid-modified enzymes can be anchored to cell surfaces

    • Potential for whole-cell biocatalysts with immobilized enzyme cascades

    • Improved stability and reusability compared to soluble enzymes

  • Membrane protein complex assembly:

    • Controlled lipoprotein modification to enhance membrane protein assembly

    • Engineering of artificial electron transport chains for bioenergy applications

    • Optimization of membrane-associated metabolic pathways

Integration with C. necator's Unique Metabolic Capabilities:

  • Enhanced carbon capture systems:

    • Engineer lipoproteins involved in CO₂ fixation pathways

    • Improve autotrophic growth capabilities through optimized membrane protein assemblies

  • Polyhydroxyalkanoate (PHA) production:

    • Modify membrane-associated PHA synthesis machinery

    • Integrate with existing recombinant systems for enhanced PHA production

    • Potential for tailored lipoprotein modifications to improve yield and product specificity

Methodological Approaches:

  • Two-phase cultivation strategy:

    • Utilizing C. necator's ability to rapidly transition between metabolic states

    • Initial autotrophic growth followed by heterotrophic production phase

    • Optimize lgt expression for each phase to support different lipoprotein needs

  • Lipoprotein display technology:

    • Using Lgt to create surface-displayed functional proteins

    • Applications in biosensing, biocatalysis, and biosorption

    • Potential for creating cell-based screening platforms

  • Integration with lipase expression systems:

    • Combine with proven recombinant lipolytic systems developed for C. necator

    • Potential for enhanced processing of fatty substrates through coordinated lipolytic and lipoprotein processing machinery

How can I integrate recombinant lgt with other lipid metabolism pathways in C. necator?

Integrating recombinant Lgt with other lipid metabolism pathways in C. necator requires strategic pathway engineering and careful consideration of metabolic interactions:

Key Integration Points:

  • Phospholipid biosynthesis:

    • Lgt utilizes phosphatidylglycerol (PG) as a substrate

    • Co-expression with phospholipid biosynthesis enzymes could enhance substrate availability

    • Consider the balance between PG consumption for lipoprotein modification versus membrane formation

  • Lipolytic systems:

    • Recombinant lipase expression has been demonstrated in C. necator (lipC and lipH from P. stutzeri)

    • Coordinated expression of lipolytic and lipoprotein processing enzymes

    • Potential for creating unified lipid processing systems

  • Polyhydroxyalkanoate (PHA) metabolism:

    • C. necator naturally produces PHAs as carbon storage

    • Balance between lipid utilization for PHA versus lipoprotein modification

    • Engineering membrane-associated PHA synthesis machinery through lipoprotein modification

Methodological Approaches:

  • Pathway modeling and flux analysis:

    • Construct metabolic models incorporating Lgt activity

    • Identify rate-limiting steps and metabolic bottlenecks

    • Optimize expression levels of pathway components

  • Multi-promoter systems:

    • Use different promoters to control expression of pathway components

    • PSH promoter for condition-specific expression

    • Constitutive promoters for baseline expression

  • Synthetic operons:

    • Create artificial operons containing lgt and complementary genes

    • Engineer polycistronic mRNAs for coordinated expression

    • Design with balanced protein expression levels

Example Integration Strategy for Slaughterhouse Waste Utilization:

Based on the successful development of lipase-expressing C. necator for processing slaughterhouse by-products , an integrated system could be designed:

Pathway ComponentFunctionGenetic OriginPromoter System
LipC/LipH LipasesExtracellular fat hydrolysisP. stutzeri BT3Constitutive
Fatty acid transportersSubstrate uptakeNative or enhancedInducible (substrate-responsive)
LgtLipoprotein processingNative or optimizedCondition-specific (PSH-type)
PHA synthasesBiopolymer productionNative or enhancedGrowth phase-dependent

This integrated approach could potentially improve the one-step processing of lipid-rich waste into valuable bioproducts, achieving up to 65% PHA content in cell dry mass as demonstrated with lipase-expressing strains .

What are the limitations and challenges in studying recombinant lgt expression in C. necator?

Researchers face several significant challenges when studying recombinant Lgt expression in C. necator:

Technical Challenges:

  • Membrane protein expression difficulties:

    • Potential toxicity from overexpression of membrane proteins

    • Proper folding and insertion into membranes

    • Challenges in solubilization and purification for characterization

  • Growth inhibition considerations:

    • High O₂ partial pressures (>0.7 atm) inhibit C. necator growth

    • Substrate inhibition observed with high acetate concentrations

    • Balancing expression levels to avoid metabolic burden

  • Genetic manipulation limitations:

    • Lower transformation efficiency compared to model organisms

    • Limited availability of genetic tools specifically optimized for C. necator

    • Complex genome with chromosomes and a megaplasmid (pHG1)

Methodological Challenges:

  • Activity assay complexities:

    • Membrane-associated enzyme requiring specialized assay conditions

    • Potential interference from native Lgt activity

    • Need for appropriate detergents to maintain activity while solubilizing

  • Expression verification:

    • Difficulties in quantifying membrane protein levels

    • Limited availability of specific antibodies against C. necator proteins

    • Challenges in distinguishing recombinant from native Lgt

Biological System Complexity:

  • Metabolic state influence:

    • Variable lag phases under different growth conditions (6-22+ hours)

    • Complex regulatory networks affecting gene expression

    • Differences in membrane composition affecting Lgt function

  • Substrate specificity uncertainties:

    • Potential differences in lipobox recognition between species

    • Variations in phospholipid composition affecting activity

    • Possible substrate competition with native Lgt

Strategies to Address Challenges:

ChallengeMethodological Solution
Membrane protein toxicityUse inducible promoters with tight regulation (e.g., PSH)
Growth inhibitionCarefully optimize O₂ levels and substrate concentrations
Genetic manipulationUse established integration methods via suicide vectors
Activity verificationDevelop GFP-based reporter systems to monitor expression
Metabolic variabilityImplement two-stage cultivation systems for controlled transitions
Specificity analysisPerform comparative studies with E. coli Lgt as reference

How can I optimize growth conditions to improve recombinant protein yield in C. necator?

Optimizing growth conditions for recombinant protein production in C. necator requires systematic adjustment of multiple parameters:

Critical Parameters for Optimization:

  • Carbon source selection and concentration:

    • Acetate: Use concentrations below inhibitory levels for short lag phase (<12h)

    • Fructose: Effective for heterotrophic growth

    • Glycerol: Useful for PSH promoter de-repression

    • H₂/O₂/CO₂ mixture (7:2:1): Optimal for autotrophic growth with short lag phase

  • Oxygen partial pressure:

    • Maintain below 0.7 atm to avoid growth inhibition

    • Values above 0.6 atm result in extended lag phases (>16h)

    • Consider microaerobic conditions for membrane protein expression

  • Growth phase harvesting:

    • Monitor growth curve using OD measurements

    • For PSH promoter-controlled expression, measure GFP fluorescence to determine optimal induction

    • Typically harvest in late exponential phase for maximum recombinant protein yield

Optimization Strategy:

ParameterTesting RangeMonitoring MethodExpected Outcome
Temperature25-35°C (2°C increments)Growth rate, protein activityOptimal balance between growth and protein folding
pH6.5-8.0 (0.3 increments)Growth rate, protein yieldOptimal cellular metabolism and protein stability
Dissolved oxygen10-40% saturationOxygen probe, growth rateBalance between metabolism and oxidative stress
Induction timingEarly, mid, late log phaseReporter fluorescenceMaximum protein accumulation before harvest
Carbon source concentration1-20 g/LSubstrate consumption, growthAvoid substrate inhibition while maintaining growth

Two-Stage Cultivation Approach:

  • Biomass accumulation stage:

    • Optimize for rapid growth and short lag phase

    • Use preferred carbon source (e.g., acetate at appropriate concentration)

    • Maintain optimal O₂ levels for growth

  • Protein expression stage:

    • Transition to conditions optimal for recombinant protein expression

    • Implement promoter induction strategy (e.g., switch to glycerol for PSH promoter)

    • Adjust parameters to favor protein folding and stability

What strategies can resolve common expression problems with recombinant lgt in C. necator?

Researchers working with recombinant Lgt in C. necator may encounter several common expression issues. Here are methodological approaches to resolve them:

Problem 1: Low expression levels

Potential causes and solutions:

  • Transcriptional issues:

    • Weak promoter activity: Test alternative promoters or engineer stronger variants

    • Poor mRNA stability: Include stabilizing RNA elements in the construct

    • Suboptimal codon usage: Perform codon optimization for C. necator

  • Translational issues:

    • Inefficient ribosome binding site (RBS): Optimize RBS sequence and spacing

    • Formation of inhibitory mRNA secondary structures: Redesign 5' UTR region

    • Analyze rare codon distribution and optimize if necessary

Problem 2: Protein misfolding or degradation

Potential causes and solutions:

  • Folding challenges:

    • Reduce expression temperature to slow folding kinetics

    • Co-express chaperones or foldases

    • Use fusion partners known to enhance solubility

  • Protein degradation:

    • Include protease inhibitors during extraction

    • Create protease-resistant variants through targeted mutations

    • Engineer constructs lacking recognized protease sites

Problem 3: Toxicity to host cells

Potential causes and solutions:

  • Membrane disruption:

    • Tight regulation of expression using inducible promoters

    • Balance expression levels to avoid membrane protein overload

    • Implement two-stage cultivation approach separating growth and expression phases

  • Metabolic burden:

    • Optimize media composition to support increased metabolic demands

    • Consider slower growth rates with controlled nutrient feeding

    • Balance expression with cellular resources

Problem 4: Improper membrane insertion

Potential causes and solutions:

  • Targeting issues:

    • Verify signal sequence functionality in C. necator

    • Ensure proper SecYEG translocon interaction

    • Consider native vs. heterologous signal sequences

  • Membrane composition mismatch:

    • Adjust growth conditions to alter membrane composition

    • Consider expression during different metabolic states

    • Optimize lipid environment through media supplementation

Troubleshooting Decision Tree:

For systematic problem resolution, follow this methodological approach:

  • Verify gene integration using PCR with primers spanning integration junctions

  • Confirm transcription using RT-PCR with lgt-specific primers

  • Check translation using Western blot with appropriately tagged constructs

  • Assess membrane localization through fractionation studies

  • Evaluate enzyme activity using established assays

  • Implement targeted solutions based on identified bottleneck

How can I establish proper controls for studying recombinant lgt function in C. necator?

Establishing appropriate controls is crucial for rigorous scientific investigation of recombinant Lgt function in C. necator:

Genetic Controls:

  • Negative controls:

    • Empty vector control: C. necator containing the expression vector without lgt gene

    • Inactive mutant control: Express catalytically inactive Lgt (mutations in critical residues like Arg143/Arg239 equivalents)

    • Native expression control: Wild-type C. necator strain with only endogenous lgt

  • Positive controls:

    • Known functional homolog: Express well-characterized Lgt from E. coli or other species

    • Tagged wild-type Lgt: Native C. necator Lgt with same tags as recombinant version

    • Complementation positive: Functional Lgt rescuing an lgt-knockout phenotype

Experimental Controls:

  • Expression verification controls:

    • Housekeeping gene references: For normalizing qRT-PCR data (e.g., 16S rRNA, rpoD)

    • GFP expression controls: If using fluorescent reporters (as in PSH promoter studies)

    • Subcellular fractionation markers: To verify proper membrane localization

  • Activity assay controls:

    • Substrate-only reactions: Measuring background reactions without enzyme

    • Heat-inactivated enzyme: To distinguish enzymatic from non-enzymatic reactions

    • Known inhibitor responses: Using palmitic acid as a characterized Lgt inhibitor

Growth and Physiological Controls:

  • Growth condition controls:

    • Standard growth curves: Under defined conditions for proper comparison

    • Metabolic state markers: Monitoring core metabolic indicators across conditions

    • Substrate utilization controls: Measuring consumption of carbon sources

  • Stress response controls:

    • High O₂ exposure: Known to extend lag phase (>22h)

    • Substrate inhibition markers: Responses to high acetate concentrations

    • General stress markers: To distinguish specific from general effects

Control Experiments Matrix:

Experiment TypePositive ControlNegative ControlValidation Method
Gene integrationPCR with known templateNo-template PCRGel electrophoresis
TranscriptionHousekeeping geneNo-RT controlqRT-PCR
TranslationKnown expressed proteinEmpty vector strainWestern blot
Membrane localizationKnown membrane proteinCytoplasmic proteinFractionation + Western
Enzymatic activityE. coli LgtHeat-inactivated enzymeActivity assay
Growth physiologyStandard conditionsInhibitory conditionsGrowth curves

By implementing this comprehensive control strategy, researchers can confidently interpret experimental results and distinguish true biological effects from technical artifacts or experimental variations.

What are the emerging research trends in recombinant lipoprotein processing in C. necator?

Several promising research directions are emerging in the field of recombinant lipoprotein processing in C. necator, driven by both technological advances and increased understanding of this versatile organism:

Integration with Sustainable Bioprocessing:

  • Development of two-stage cultivation systems that leverage C. necator's metabolic flexibility for optimized recombinant protein production

  • Application of recombinant lipoprotein processing for improved valorization of waste streams, similar to advances with lipase-expressing C. necator strains for processing slaughterhouse waste

  • Exploration of CO2 capture and utilization through engineered lipoprotein systems integrated with C. necator's autotrophic metabolism

Advanced Genetic Engineering Approaches:

  • Implementation of CRISPR-Cas systems for precise genetic manipulation of C. necator

  • Development of advanced promoter systems building on the success of the PSH promoter reporter system

  • Creation of synthetic regulatory circuits for dynamic control of lipoprotein processing in response to changing growth conditions

Structure-Function Relationships:

  • Application of cryo-EM techniques to determine membrane protein structures in native-like environments

  • Comparative structural analysis between E. coli and C. necator Lgt to identify species-specific features

  • Rational design of Lgt variants with enhanced activity or altered substrate specificity

Biotechnological Applications:

  • Engineering of lipoprotein anchoring systems for whole-cell biocatalysis

  • Development of biosensors based on surface-displayed lipoproteins

  • Integration with polyhydroxyalkanoate (PHA) production pathways for enhanced biopolymer synthesis

How can computational approaches enhance our understanding of lgt function in C. necator?

Computational methods offer powerful tools for investigating Lgt function in C. necator, providing insights that might be challenging to obtain through experimental approaches alone:

Structural Bioinformatics:

  • Homology modeling:

    • Generate structural models of C. necator Lgt based on E. coli Lgt crystal structure

    • Identify conserved structural features and species-specific variations

    • Predict substrate binding sites and catalytic residues

  • Molecular dynamics simulations:

    • Model Lgt behavior within a lipid bilayer environment

    • Investigate conformational changes during substrate binding and product release

    • Simulate the effects of mutations on protein stability and function

  • Protein-substrate docking:

    • Predict interactions between Lgt and phosphatidylglycerol

    • Model binding of various lipobox peptide sequences

    • Design potential inhibitors or activity enhancers

Systems Biology Approaches:

  • Metabolic modeling:

    • Integrate Lgt function into genome-scale metabolic models of C. necator

    • Predict effects of altered Lgt activity on cellular metabolism

    • Identify optimal conditions for lipoprotein production

  • Transcriptomic analysis:

    • Predict regulatory networks controlling lgt expression

    • Identify co-regulated genes that may function in related pathways

    • Design optimal expression strategies based on transcriptional patterns

  • Comparative genomics:

    • Analyze Lgt conservation across bacterial species

    • Identify unique features of C. necator Lgt compared to other bacteria

    • Discover potential functional partners through gene neighborhood analysis

Machine Learning Applications:

  • Protein engineering:

    • Predict mutations that enhance stability or activity

    • Design Lgt variants with altered substrate specificity

    • Optimize enzyme performance under specific conditions

  • Expression optimization:

    • Predict optimal codon usage for C. necator

    • Design mRNA sequences with favorable folding properties

    • Identify optimal regulatory elements for controlled expression

These computational approaches can guide experimental design, reduce the number of experiments needed, and provide mechanistic insights that might be difficult to obtain through experimental methods alone.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.