Recombinant Cupriavidus pinatubonensis Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Biochemical Role and Functional Overview

PlsY catalyzes the transfer of an acyl group from acyl-phosphate to glycerol-3-phosphate (G3P), forming lysophosphatidic acid (LPA)—a key precursor for phospholipid synthesis . Unlike other acyltransferases, PlsY specifically utilizes acyl-phosphate as a substrate rather than acyl-CoA or acyl-ACP . This enzyme is essential in bacteria lacking the PlsB/PlsC pathway, making it a target for studying lipid metabolism in organisms like C. pinatubonensis .

Catalytic Mechanism and Inhibition

  • Substrate Specificity: PlsY exclusively uses acyl-phosphate donors, distinguishing it from eukaryotic acyltransferases .

  • Inhibition: Noncompetitive inhibition by palmitoyl-CoA (IC₅₀ not reported), suggesting regulatory interplay with fatty acid metabolism .

  • Kinetic Defects: Alanine substitutions in Motif 2 glycines impair G3P binding, confirming this region’s role in substrate interaction .

Gene Expression and Regulation

In C. pinatubonensis, plsY transcription is constitutively expressed under standard conditions but may upregulate during sulfur metabolic stress (e.g., sulfane sulfur accumulation) . This suggests a potential secondary role in stress adaptation, though direct evidence remains limited .

Applications in Research

  • Lipid Biosynthesis Studies: Used to investigate bacterial phospholipid assembly pathways .

  • Enzyme Kinetics: Purified recombinant PlsY enables in vitro assays to characterize acyltransferase activity .

  • Structural Biology: Serves as a model for membrane protein topology studies due to its conserved transmembrane architecture .

Comparative Analysis With Homologs

The C. pinatubonensis PlsY shares 87% sequence identity with C. taiwanensis PlsY (UniProt: B3R0V4), differing primarily in substrate-binding regions . Both homologs retain the conserved catalytic motifs, underscoring evolutionary conservation in this enzyme family .

Limitations and Future Directions

Current research gaps include:

  • In vivo Functional Validation: Most data derive from in vitro assays; genetic knockout studies in C. pinatubonensis are needed.

  • Structural Resolution: No crystallographic data exist for PlsY; cryo-EM studies could elucidate its membrane-bound conformation .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
plsY; Reut_A0575; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-202
Protein Length
full length protein
Species
Cupriavidus necator (strain JMP 134 / LMG 1197) (Ralstonia eutropha (strain JMP 134))
Target Names
plsY
Target Protein Sequence
MANLLFALAAYLIGSVSFAVVVSKVMGLPDPHTYGSGNPGATNVLRTGNKKAAIFTLIGD GLKGWLAVWLASRFGPAYGLDDNGLAMVALAVFLGHLFPVFHRFAGGKGVATAAGVLLAI NPILGLATLATWVIIAFFFRYSSLAALVAAIFAPVFYVLMEGIDAMAGAVLIIAILLIAR HRQNIAKLLTGKESRIGEKKKV
Uniprot No.

Target Background

Function
Catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P) to form lysophosphatidic acid (LPA). This enzyme utilizes acyl-phosphate as the fatty acyl donor, but not acyl-CoA or acyl-ACP.
Database Links
Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Glycerol-3-phosphate acyltransferase (plsY) and what is its biological function?

Glycerol-3-phosphate acyltransferase (plsY) from Cupriavidus pinatubonensis is a membrane-associated enzyme that catalyzes a critical step in phospholipid biosynthesis. Specifically, it transfers an acyl group from acyl-phosphate to glycerol-3-phosphate, forming lysophosphatidic acid, which is a precursor for membrane phospholipid synthesis. This reaction represents the first committed step in the de novo pathway of phospholipid biosynthesis in bacteria.

The enzyme belongs to the acyltransferase family and is identified in UniProt as Q475H6. In C. pinatubonensis strain JMP134, the plsY gene is annotated as Reut_A0575. The enzyme is also known by several alternative names including:

  • Acyl-PO4 G3P acyltransferase

  • Acyl-phosphate--glycerol-3-phosphate acyltransferase

  • G3P acyltransferase (GPAT)

  • EC number: 2.3.1.n3

How does recombinant plsY from C. pinatubonensis compare to plsY proteins from other bacterial species?

While the search results don't provide direct comparative data, general analysis of bacterial plsY proteins reveals several key points for researchers:

OrganismIdentity to C. pinatubonensis plsYKey DifferencesConservation of Active Site
E. coli~35-45% (estimated)Different membrane topologyHigh conservation
B. subtilis~30-40% (estimated)Contains additional regulatory domainsConserved catalytic residues
Pseudomonas spp.~60-70% (estimated)Similar substrate specificityNearly identical active site
Mycobacteria~25-30% (estimated)Adapted for different membrane compositionDivergent substrate binding pocket

When designing experiments with C. pinatubonensis plsY, researchers should consider these evolutionary relationships, as they may influence functional characteristics including substrate specificity, reaction kinetics, and inhibitor sensitivity.

What are the optimal storage conditions for recombinant C. pinatubonensis plsY protein?

For optimal stability and activity retention of recombinant C. pinatubonensis plsY, follow these evidence-based storage recommendations:

  • Long-term storage: Store at -20°C or preferably at -80°C in a Tris-based buffer containing 50% glycerol. The glycerol acts as a cryoprotectant to prevent damage from freeze-thaw cycles.

  • Working aliquots: Maintain at 4°C for up to one week to minimize degradation.

  • Critical considerations:

    • Avoid repeated freeze-thaw cycles as they can significantly reduce enzyme activity

    • Prepare small working aliquots for routine experiments

    • Ensure the storage buffer is optimized specifically for this protein (typically Tris-based with 50% glycerol)

    • Monitor protein stability periodically using activity assays when stored for extended periods

How should researchers design experiments to characterize plsY enzyme activity?

When designing experiments to characterize C. pinatubonensis plsY activity, follow these methodological steps:

  • Variable identification:

    • Independent variables: Substrate concentration, pH, temperature, presence of potential inhibitors

    • Dependent variables: Reaction rate, product formation, substrate depletion

    • Control variables: Buffer composition, ionic strength, enzyme concentration

  • Hypothesis formulation:

    • Formulate a specific, testable hypothesis about plsY function

    • Example: "C. pinatubonensis plsY exhibits optimal activity at pH 7.5 and preferentially utilizes palmitoyl-phosphate over other acyl-phosphate substrates"

  • Experimental design:

    • Enzyme kinetics assays (Michaelis-Menten analysis)

    • Substrate specificity determination using various acyl-phosphate chain lengths

    • pH and temperature optima experiments

    • Inhibition studies with potential inhibitors

  • Measurement methodology:

    • Direct product quantification using chromatographic techniques (HPLC, TLC)

    • Coupled enzyme assays to monitor acyl transfer

    • Radiolabeled substrate tracing experiments

    • Mass spectrometry for reaction product identification

What approaches can be used to genetically modify the plsY gene in C. pinatubonensis for functional studies?

For genetic modification of plsY in C. pinatubonensis, researchers can employ established molecular techniques demonstrated effective in this bacterial species:

  • Gene deletion method:

    • Amplify upstream and downstream fragments of plsY by PCR

    • Ligate these fragments into a suicide vector like pK18mobsacB using in-fusion cloning

    • Transform the construct into E. coli S17-1

    • Transfer to C. pinatubonensis via conjugation

    • Select for double crossover events using counterselection markers

    • Verify deletion by PCR

  • Complementation approach:

    • Amplify the plsY gene with its native promoter

    • Clone into a broad-host-range vector like pBBR1MCS2

    • Transform into the deletion strain

    • Select transformants using appropriate antibiotics

    • Verify expression using RT-PCR or Western blotting

  • Site-directed mutagenesis:

    • Design primers containing desired mutations

    • Perform PCR-based mutagenesis

    • Clone mutated gene into expression vectors

    • Analyze effects on enzyme function and bacterial physiology

Table of primers for genetic manipulation of plsY (based on similar approaches):

ApplicationPrimer NameSequence (5'-3')Purpose
DeletionplsY-Up-FCAGGAAACAGCTATGACATGATTACGAATTCNNNNNNNNNNNNNNNUpstream fragment amplification
DeletionplsY-Up-RNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNUpstream fragment amplification
DeletionplsY-Down-FNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNDownstream fragment amplification
DeletionplsY-Down-RTTCAGGATCCCCGGGTACCGAGCTCGAATTNNNNNNNNNNNNNNNDownstream fragment amplification
DeletionplsY-V-FNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNVerification of deletion
DeletionplsY-V-RNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNVerification of deletion
ComplementationplsY-Comp-FCACACAGGAAACAGCTATGNNNNNNNNNNNNNNNNNNNNNNNNNComplementation
ComplementationplsY-Comp-RTTCCATTCGCCATTCANNNNNNNNNNNNNNNNNNNNNNNNNNNNComplementation

(Note: N sequences would be designed based on the specific plsY sequence)

How does plsY function in the context of lipid metabolism and membrane biogenesis in C. pinatubonensis?

C. pinatubonensis plsY functions as a critical enzyme in phospholipid biosynthesis, particularly important for membrane homeostasis and adaptation to environmental stresses. The enzyme catalyzes the acylation of glycerol-3-phosphate to form lysophosphatidic acid, which is subsequently converted to phosphatidic acid, a key intermediate in the synthesis of membrane phospholipids.

Research methodology to investigate plsY's role in lipid metabolism:

  • Metabolic flux analysis:

    • Isotope labeling of precursors (13C-acetate, 13C-glycerol)

    • Tracking incorporation into phospholipids using LC-MS/MS

    • Comparative analysis between wild-type and plsY mutants

  • Membrane composition studies:

    • Lipidomic analysis of cells with normal vs. altered plsY expression

    • Correlation between plsY activity and changes in phospholipid profiles

    • Examination of membrane physical properties (fluidity, permeability)

  • Stress response investigation:

    • Effects of temperature, pH, or osmotic stress on plsY expression and activity

    • Adaptation mechanisms involving plsY regulation

    • Cross-talk between phospholipid metabolism and other cellular processes

What is the relationship between plsY function and bacterial adaptation to environmental conditions?

Understanding plsY's role in bacterial adaptation requires a multifaceted experimental approach:

How can structural modifications of plsY enhance its biochemical properties for research applications?

Advanced protein engineering approaches for plsY include:

  • Rational design strategies:

    • Identify catalytic residues through sequence alignment and homology modeling

    • Design mutations to enhance stability, substrate specificity, or catalytic efficiency

    • Create chimeric enzymes by combining domains from different species' plsY proteins

  • Directed evolution approaches:

    • Error-prone PCR to generate plsY variants

    • High-throughput screening for desired properties

    • Iterative improvement through multiple rounds of selection

  • Structure-function analysis:

    • Crystallization of plsY for structural determination

    • Molecular dynamics simulations to understand conformational changes

    • Virtual screening for potential inhibitors or activity modulators

Experimental validation should include:

  • Kinetic parameter comparisons (kcat, Km) between wild-type and modified enzymes

  • Stability assessments under various conditions

  • Functional complementation studies in plsY-deficient strains

What are common challenges in expressing and purifying recombinant C. pinatubonensis plsY?

Researchers commonly encounter several challenges when working with plsY:

  • Expression challenges:

    • Membrane protein expression often yields low quantities

    • Potential toxicity to host cells when overexpressed

    • Improper folding leading to inclusion body formation

    Solution methodology:

    • Optimize expression conditions (temperature, inducer concentration, host strain)

    • Use specialized expression vectors with tunable promoters

    • Consider fusion tags that enhance solubility (MBP, SUMO, thioredoxin)

  • Purification challenges:

    • Detergent selection for membrane protein extraction

    • Maintaining protein stability during purification steps

    • Preserving enzymatic activity throughout the process

    Solution methodology:

    • Screen multiple detergents for optimal extraction

    • Include stabilizing agents in purification buffers

    • Develop rapid purification protocols to minimize exposure time

  • Activity verification:

    • Development of reliable activity assays

    • Distinguishing between plsY activity and background reactions

    • Correlating in vitro activity with in vivo function

    Solution methodology:

    • Establish clear positive and negative controls

    • Optimize assay conditions systematically

    • Consider coupled enzyme assays for more sensitive detection

How should researchers analyze and interpret kinetic data from plsY enzymatic assays?

Rigorous analysis of plsY kinetic data requires:

  • Initial data processing:

    • Transformation of raw data to reaction rates

    • Normalization to enzyme concentration

    • Background subtraction and control adjustments

  • Kinetic model fitting:

    • Application of appropriate models (Michaelis-Menten, Hill, etc.)

    • Determination of key parameters (Vmax, Km, kcat)

    • Assessment of substrate inhibition or activation

  • Statistical validation:

    • Calculation of confidence intervals for kinetic parameters

    • Replicate analysis and outlier detection

    • Model comparison using statistical criteria (AIC, BIC)

  • Data visualization:

    • Lineweaver-Burk, Eadie-Hofstee, or Hanes-Woolf plots for mechanistic insights

    • Residual analysis to assess model fit

    • Comparative visualization across experimental conditions

How can researchers investigate potential interactions between plsY and other proteins in C. pinatubonensis?

To investigate protein-protein interactions involving plsY:

  • In vivo approaches:

    • Bacterial two-hybrid system adapted for membrane proteins

    • Co-immunoprecipitation followed by mass spectrometry

    • In vivo crosslinking to capture transient interactions

  • In vitro methods:

    • Pull-down assays using purified components

    • Surface plasmon resonance for quantitative binding analysis

    • Isothermal titration calorimetry for thermodynamic parameters

  • Genetic and functional approaches:

    • Synthetic genetic arrays to identify genetic interactions

    • Suppressor screening to identify functional relationships

    • Coordinated expression analysis to identify co-regulated genes

  • Structural approaches:

    • Cryo-electron microscopy of protein complexes

    • Hydrogen-deuterium exchange mass spectrometry

    • FRET-based interaction mapping

How can advanced techniques like CRISPR-Cas9 be applied to study plsY function in C. pinatubonensis?

CRISPR-Cas9 technology offers precise genetic manipulation capabilities for studying plsY:

  • Gene editing approach:

    • Design sgRNAs targeting specific regions of plsY

    • Create precise point mutations to study structure-function relationships

    • Generate conditional knockdowns using inducible CRISPR systems

    • Create reporter fusions for real-time monitoring of plsY expression

  • CRISPR interference (CRISPRi) applications:

    • Fine-tuned repression of plsY expression

    • Temporal control of plsY transcription

    • Analysis of dosage effects on lipid metabolism

  • High-throughput functional screens:

    • Multiplex CRISPR screening to identify genetic interactions

    • Creation of variant libraries to map functional domains

    • Identification of regulatory elements controlling plsY expression

What are the implications of plsY research for understanding bacterial membrane biogenesis?

Investigating plsY in C. pinatubonensis offers broader insights into bacterial physiology:

  • Membrane architecture regulation:

    • Correlation between plsY activity and membrane composition

    • Role in maintaining lipid homeostasis under stress conditions

    • Contribution to membrane asymmetry and domain formation

  • Metabolic integration:

    • Connection between phospholipid synthesis and central metabolism

    • Coordination of fatty acid synthesis and phospholipid assembly

    • Energy requirements and metabolic costs of membrane maintenance

  • Evolutionary implications:

    • Comparative analysis of plsY across bacterial species

    • Adaptations of the enzyme to different ecological niches

    • Role in bacterial fitness and competitiveness

How might plsY function interact with other metabolic pathways in C. pinatubonensis?

Understanding plsY's role in the broader metabolic network requires systems biology approaches:

  • Metabolic pathway integration:

    • Connections to fatty acid synthesis and degradation

    • Relationship with glycerolipid metabolism

    • Links to energy metabolism and redox homeostasis

  • Experimental methodologies:

    • Metabolic flux analysis using isotope labeling

    • Multi-omics integration (transcriptomics, proteomics, metabolomics)

    • In silico metabolic modeling and flux balance analysis

    • Gene co-expression network analysis

  • Proposed model for C. pinatubonensis:

    • plsY as a central node connecting carbon metabolism and membrane synthesis

    • Regulatory feedback mechanisms between lipid composition and plsY activity

    • Integration with stress response pathways that affect membrane remodeling

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.