Recombinant Cupriavidus pinatubonensis Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Description

Introduction to Lipoprotein Signal Peptidase (LspA)

Lipoprotein signal peptidase (LspA) is an essential aspartyl protease responsible for cleaving the signal peptide from prolipoproteins during bacterial lipoprotein maturation . This enzyme is conserved across Gram-positive and Gram-negative bacteria, including Cupriavidus pinatubonensis, and plays a critical role in maintaining cell envelope integrity, pathogenicity, and antibiotic resistance . Recombinant forms of LspA are engineered for structural and functional studies, enabling insights into its catalytic mechanism and antibiotic targeting .

2.1. Molecular Architecture

  • Catalytic Mechanism: LspA operates via an aspartyl peptidase mechanism, with a catalytic dyad (D124 and D143 in Pseudomonas aeruginosa) critical for cleaving the signal peptide after the conserved "lipobox" motif .

  • Membrane Localization: As a transmembrane protein, LspA anchors in the cytoplasmic membrane, positioning its active site to process lipoproteins destined for the periplasm or extracellular space .

Table 2: Example Recombinant LspA Production

ParameterDetail
Host OrganismE. coli
TagN-terminal His-tag
Protein Length1-176 amino acids (full-length)
ApplicationsEnzyme kinetics, inhibitor screening

3.2. Inhibitor Studies

Globomycin and synthetic analogs (e.g., G2a, G2d) inhibit LspA by mimicking the lipobox substrate, blocking the active site . These inhibitors show nanomolar IC50 values against LspA homologs and antimicrobial activity against ESKAPE pathogens .

4.1. Antibiotic Resistance

Disruption of lspA in S. aureus increases susceptibility to human group IIA phospholipase A2 (hGIIA), highlighting its role in evading host immune responses . Inhibitors targeting LspA could bypass traditional resistance mechanisms, offering novel therapeutic strategies .

4.2. Metabolic Integration in C. pinatubonensis

While C. pinatubonensis LspA has not been directly studied, its genome encodes sulfur-oxidizing enzymes (e.g., SQR, PDO, Sox system) that depend on lipoprotein trafficking . Proper LspA function ensures these enzymes localize correctly to oxidize sulfide, mitigating sulfane sulfur toxicity .

Future Directions

  • Structural Studies: High-resolution crystallography of C. pinatubonensis LspA could refine inhibitor design for species-specific targeting .

  • Functional Genomics: Knockout studies would clarify LspA’s role in sulfur metabolism and stress response .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate your specific format requirements. Please indicate your preferred format in the order notes, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. For lyophilized forms, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please let us know, and we will prioritize developing the specified tag.
Synonyms
lspA; Reut_A2746; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
full length protein
Species
Cupriavidus necator (strain JMP 134 / LMG 1197) (Ralstonia eutropha (strain JMP 134))
Target Names
lspA
Target Protein Sequence
MASTTSRSARPARRNNKASGNTTPLLWMAFALLVVVLDQFFKIVIVRTFTYGESRPVTRF FNLVLVYNKGAAFSFLADAGGWQRWFFTGLGLVVGAFIVWLLYRHTGQKLFCFAVSLILG GAVGNVVDRVVYGHVIDFLDFYVRNYHWPAFNVADCAITVGAVLLIVDELRRVRKH
Uniprot No.

Target Background

Function
This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Lipoprotein Signal Peptidase (LspA) and what role does it play in bacterial physiology?

Lipoprotein Signal Peptidase (LspA) is a critical enzyme in the bacterial lipoprotein processing pathway that contributes to the integrity and function of the bacterial cell envelope. LspA functions as a type II signal peptidase that cleaves the signal peptide from prolipoproteins after lipid modification by Lgt (lipoprotein diacylglyceryl transferase). This processing is essential for proper lipoprotein localization and function in the bacterial cell envelope .

The enzyme is typically membrane-embedded and represents an attractive target for antibiotic development due to its essential nature in many bacteria and absence in human cells. In pathogenic bacteria like Staphylococcus aureus, LspA processing is crucial for maintaining cell envelope integrity, and its inhibition can compromise bacterial viability .

How does LspA enzymatic activity compare between different bacterial species?

LspA enzymatic activity varies significantly between bacterial species, as demonstrated by comparative studies. For example, when comparing LspA from Staphylococcus aureus (LspMrs) with Pseudomonas aeruginosa LspA (LspPae), substantial differences in catalytic efficiency are observed:

ParameterLspMrs (S. aureus)LspPae (P. aeruginosa)
Enzyme concentration used0.3 μM0.1 μM
Apparent Km47 μM10 μM
Vmax2.5 nmol/(mg min)107 nmol/(mg min)
Substrate affinityLowerHigher
Catalytic rateSlowerFaster

These differences suggest that the S. aureus ortholog is a slower-acting peptidase with lower substrate affinity compared to its P. aeruginosa counterpart . When studying LspA from Cupriavidus pinatubonensis, researchers should anticipate potential species-specific variations in enzymatic properties.

What genetic characteristics are known about Cupriavidus pinatubonensis that might influence LspA research?

Cupriavidus pinatubonensis (formerly known as Ralstonia eutropha or Cupriavidus necator) is a versatile bacterium known for its ability to utilize a variety of carbon sources, including aromatic compounds. The strain JMP134 has been particularly well-studied for its ability to degrade meta-nitrophenol (MNP) and other aromatic substrates .

While specific information about the lspA gene in C. pinatubonensis is limited in the current literature, the organism's genetic characteristics demonstrate sophisticated regulatory mechanisms that respond to different growth conditions. For example, the differential regulation observed with phaC1 and phaC2 genes (encoding polyhydroxyalkanoate synthases) suggests that C. pinatubonensis has evolved complex transcriptional control systems that respond to substrate availability . This characteristic may extend to the regulation of lipoprotein processing pathways, including lspA expression.

What expression systems have proven effective for recombinant LspA proteins?

Based on successful approaches with other bacterial LspA proteins, in vivo expression methods have yielded active enzyme preparations. For LspA from S. aureus (LspMrs), recombinant expression with a hexahistidine tag produced functional enzyme that demonstrated activity in both gel-shift and FRET assays . The following expression approach has been documented:

  • Cloning the lspA gene into an expression vector with a hexahistidine tag

  • Expression in a bacterial host system under optimized conditions

  • Verification of expression through SDS-PAGE and Western blotting

  • Activity assessment of the expressed protein using appropriate assays

For C. pinatubonensis proteins, heterologous expression in E. coli has been successfully employed for other enzymes from this organism, suggesting a similar approach might be effective for LspA .

What are the critical considerations for maintaining LspA activity during purification?

Maintaining LspA activity during purification is challenging due to its membrane-associated nature. Based on successful purification of LspA from other bacterial species, researchers should consider:

  • Careful selection of detergents that maintain the native conformation of the enzyme

  • Temperature control throughout the purification process

  • Addition of stabilizing agents such as glycerol or specific lipids

  • Limited exposure to potential inhibitors or proteases

  • Rapid processing to minimize time in non-optimal conditions

For membrane proteins like LspA, detergent selection is particularly critical. Lauryl maltose neopentyl glycol (LMNG) has been used successfully in activity assays for LspA and might be suitable for purification of C. pinatubonensis LspA.

How can researchers verify the activity of purified recombinant LspA?

To verify the activity of purified recombinant LspA, researchers can employ multiple complementary approaches:

  • Gel-shift assay: This coupled assay involves incubating the enzyme with a substrate prolipoprotein (such as proICP) and detecting the mobility shift of the processed product on SDS-PAGE. This method allows for time-course measurements and inhibitor studies .

  • FRET-based assay: Using a single-molecule FRET lipopeptide substrate that shows changes in fluorescence upon cleavage. This provides a more quantitative and sensitive measurement of enzyme activity .

  • Inhibition studies: Sensitivity to known LspA inhibitors such as globomycin can confirm the functional identity of the purified enzyme. The IC50 value should approach the enzyme concentration used in the assay for tight-binding inhibitors .

A combination of these methods provides robust validation of enzyme activity and can reveal important enzymatic parameters including Km, Vmax, and inhibitor sensitivity.

What structural features are critical for LspA function based on crystallographic studies?

Crystallographic studies of LspA from S. aureus in complex with inhibitors have revealed key structural features that are likely to be conserved across bacterial species, including C. pinatubonensis:

  • A membrane-embedded architecture with multiple transmembrane segments

  • A catalytic site accessible to the lipid bilayer for processing of membrane-anchored prolipoproteins

  • Specific binding pockets that accommodate the signal peptide of substrate prolipoproteins

  • Structural elements that interact with inhibitors like globomycin and myxovirescin

Crystal structures have shown that while inhibitors like globomycin and myxovirescin have different molecular structures, they inhibit LspA in an identical manner, functioning as non-cleavable tetrahedral intermediate analogs . These inhibitors superpose along nineteen contiguous atoms that interact similarly with the enzyme, recapitulating part of the substrate lipoprotein in its proposed binding mode .

How do natural inhibitors interact with LspA, and what does this reveal about enzyme mechanism?

Natural inhibitors of LspA, such as globomycin and myxovirescin, provide valuable insights into the enzyme's mechanism:

  • Despite having different molecular structures, these inhibitors bind to LspA in remarkably similar ways, representing a case of convergent evolution in natural products .

  • Both inhibitors function as tetrahedral intermediate analogs, mimicking the transition state of the catalytic reaction .

  • The inhibitors superpose along nineteen contiguous atoms that interact similarly with LspA, suggesting a common binding motif that recapitulates part of the substrate lipoprotein .

  • Inhibition studies with LspA from different bacterial species show variations in sensitivity. For example, LspMrs from S. aureus shows different IC50 values depending on the substrate used in the assay:

    • With a FRET peptide substrate: IC50 approaches enzyme concentration, consistent with tight binding

    • With proICP lipoprotein substrate: IC50 of 171 μM at an enzyme concentration of 0.5 μM, suggesting substrate-dependent inhibition characteristics

This information provides a foundation for studying inhibitor interactions with C. pinatubonensis LspA and developing specific inhibitors targeting this enzyme.

What methods are most effective for studying substrate specificity of LspA?

To study substrate specificity of LspA, researchers can employ several complementary approaches:

  • Gel-shift assays with various prolipoproteins: By testing multiple natural substrates, researchers can assess preferences for different signal peptide sequences. This approach has been used successfully to study LspA from S. aureus using the proICP substrate .

  • FRET-based assays with synthetic peptide substrates: Custom-designed FRET peptides with variations in key positions can reveal sequence preferences at the cleavage site and surrounding regions .

  • Mutational analysis of substrates: Systematic mutation of substrate residues can identify key determinants of recognition and processing efficiency.

  • Computational modeling: Based on crystal structures of LspA-inhibitor complexes, in silico docking of substrate variants can predict binding modes and processing efficiency.

For the specific study of C. pinatubonensis LspA, researchers might utilize native lipoproteins from this organism as substrates to assess natural substrate preferences, potentially uncovering unique specificities compared to LspA enzymes from other species.

How can LspA be utilized as a target for novel antibiotic development?

LspA represents an attractive target for novel antibiotic development for several reasons:

  • Essentiality: LspA is critical for bacterial cell envelope integrity and function in many pathogenic bacteria .

  • Absence in humans: As a prokaryotic-specific enzyme, inhibitors targeting LspA are less likely to cross-react with human enzymes, potentially reducing toxicity concerns.

  • Existing natural inhibitors: Natural products like globomycin and myxovirescin provide proven scaffolds that can be optimized for improved pharmacokinetic properties .

  • Structural insights: Crystal structures of LspA-inhibitor complexes reveal a conserved 19-atom motif that recapitulates part of the substrate lipoprotein binding mode, offering a template for rational drug design .

Research on C. pinatubonensis LspA could provide complementary insights into conserved features across different bacterial LspA enzymes, potentially contributing to the development of broad-spectrum inhibitors.

What high-throughput screening methods can be used to identify novel LspA inhibitors?

Several high-throughput screening approaches can be employed to identify novel LspA inhibitors:

  • FRET-based activity assays: Using fluorescent peptide substrates to measure inhibition of LspA activity in a microplate format .

  • Thermal shift assays: Monitoring changes in protein thermal stability upon inhibitor binding to identify compounds that interact with LspA.

  • Surface plasmon resonance (SPR): Detecting direct binding of compounds to immobilized LspA, allowing for real-time kinetic analysis.

  • Whole-cell assays with reporter systems: Engineering bacterial strains where LspA inhibition leads to a measurable phenotype, such as growth inhibition or reporter gene activation.

The optimization of these assays for C. pinatubonensis LspA would require:

  • Expression and purification of the recombinant enzyme

  • Development of suitable substrate analogs

  • Validation with known inhibitors like globomycin

  • Miniaturization and automation for high-throughput screening

How do differences in LspA structure across bacterial species affect inhibitor design strategies?

Differences in LspA structure across bacterial species have significant implications for inhibitor design:

  • Varying sensitivity to known inhibitors: Studies show that LspA enzymes from different species exhibit different sensitivities to inhibitors like globomycin. For example, LspMrs (S. aureus) shows different IC50 values depending on the substrate used .

  • Species-specific binding pockets: While the catalytic mechanism is conserved, subtle differences in binding pocket architecture can affect inhibitor affinity and specificity.

  • Variable substrate preferences: Differences in natural substrate processing efficiency may translate to different inhibitor binding profiles.

A comprehensive approach to inhibitor design would involve:

  • Comparative structural analysis of LspA from multiple bacterial species

  • Identification of conserved binding motifs for broad-spectrum activity

  • Exploration of species-specific features for selective targeting

  • Development of inhibitor panels with varying specificity profiles

Studying LspA from non-pathogenic species like C. pinatubonensis alongside pathogenic species provides valuable comparative data for understanding structural determinants of inhibitor specificity.

How should researchers design experiments to characterize substrate specificity of C. pinatubonensis LspA?

To characterize substrate specificity of C. pinatubonensis LspA, researchers should consider a systematic experimental design:

  • Identification and cloning of native C. pinatubonensis lipoproteins: Based on genomic analysis, identify putative lipoproteins with type II signal peptides as potential natural substrates.

  • Development of an in vitro processing assay: Design a coupled assay system similar to that used for S. aureus LspA, incorporating:

    • Expression and purification of C. pinatubonensis Lgt enzyme for the first step of lipoprotein processing

    • Preparation of pre-prolipoproteins as substrates

    • Appropriate lipid components (like DOPG) at 250 μM concentration

    • Optimized buffer conditions (e.g., 50 mM Tris/HCl pH 7.5, 150 mM NaCl, 1 mM DTT)

  • Comparative processing analysis: Test multiple substrate candidates under standardized conditions to identify preferred substrates and processing kinetics.

  • Mutational analysis of signal peptides: Create variants of well-processed substrates to map the sequence determinants of recognition and cleavage.

This methodical approach will provide a comprehensive characterization of substrate specificity that can be compared with LspA enzymes from other bacterial species.

What controls and validation steps are essential when studying recombinant LspA activity?

When studying recombinant LspA activity, several critical controls and validation steps should be incorporated:

  • Enzyme activity controls:

    • Positive control using a known active LspA enzyme (e.g., from E. coli or S. aureus)

    • Negative control using catalytically inactive LspA mutant

    • No-enzyme control to establish baseline measurements

  • Substrate validation:

    • Verification of substrate quality through mass spectrometry

    • Confirmation of lipid modification by Lgt using appropriate analytical methods

    • Testing of known LspA substrates alongside novel candidates

  • Inhibition controls:

    • Dose-response curves with known LspA inhibitors like globomycin

    • Specificity controls with inhibitors of other peptidases

    • Vehicle controls for inhibitor solvents

  • Assay validation parameters:

    • Linearity of response with respect to enzyme concentration and time

    • Reproducibility across multiple enzyme preparations

    • Sensitivity and dynamic range determination

    • Z-factor calculation for high-throughput applications

These controls ensure the reliability and interpretability of results when characterizing novel LspA enzymes like that from C. pinatubonensis.

How can researchers address challenges in expressing and studying membrane proteins like LspA?

Membrane proteins like LspA present unique challenges that require specialized approaches:

  • Expression optimization strategies:

    • Testing multiple expression hosts (E. coli, yeast, insect cells)

    • Exploring fusion partners that enhance solubility and folding

    • Optimizing induction conditions (temperature, inducer concentration, duration)

    • Considering membrane-targeted expression systems

  • Solubilization and purification approaches:

    • Screening detergent panels to identify optimal solubilization conditions

    • Incorporating lipids or lipid-like molecules during purification

    • Using styrene-maleic acid copolymer (SMA) for native nanodiscs

    • Employing gentle purification procedures to maintain native conformation

  • Activity preservation strategies:

    • Including specific lipids known to support activity

    • Optimizing buffer components and pH

    • Adding stabilizing agents like glycerol

    • Minimizing freeze-thaw cycles and storage time

  • Structural characterization methods:

    • Circular dichroism to assess secondary structure integrity

    • Limited proteolysis to evaluate folding quality

    • Thermal shift assays to monitor stability under different conditions

    • Advanced techniques like HDX-MS to probe conformational dynamics

These approaches help overcome the inherent challenges in working with membrane proteins like LspA and increase the likelihood of obtaining functionally active preparations.

How does C. pinatubonensis LspA compare to homologous enzymes in other bacterial species?

While specific information about C. pinatubonensis LspA is limited, a comparative analysis can be extrapolated based on known patterns in bacterial LspA enzymes and other C. pinatubonensis proteins:

  • Sequence conservation patterns: LspA proteins typically show conservation in catalytic residues and membrane-spanning regions, with variability in peripheral regions. Based on studies of other membrane proteins in C. pinatubonensis, we might expect similar patterns of conservation.

  • Regulatory mechanisms: C. pinatubonensis has demonstrated sophisticated gene regulation in response to different carbon sources, as observed with phaC1 and phaC2 genes (70-fold higher transcription of phaC1 in MNP-grown cells, but 240-fold lower in octanoate-grown cells) . Similar substrate-responsive regulation might occur with lspA.

  • Evolutionary relationships: C. pinatubonensis has shown unique evolutionary paths for some protein families, as seen with its class II PHA synthase gene cluster organization, which differs markedly from previously reported arrangements . This suggests potential unique features in other protein families including lipoprotein processing enzymes.

A detailed comparative analysis would require cloning and characterization of C. pinatubonensis LspA alongside homologs from other species under identical experimental conditions.

What insights can be gained from studying signal peptide processing across different bacterial species?

Studying signal peptide processing across different bacterial species, including C. pinatubonensis, can provide valuable insights:

  • Evolutionary adaptation: Differences in signal peptide recognition and processing may reflect adaptation to specific ecological niches or membrane compositions.

  • Substrate co-evolution: The relationship between signal peptidases and their substrates can reveal co-evolutionary patterns that inform our understanding of bacterial protein secretion and membrane organization.

  • Regulatory diversity: Different bacteria may employ distinct regulatory mechanisms for controlling signal peptidase activity in response to environmental conditions, as suggested by the differential regulation observed for other genes in C. pinatubonensis .

  • Structural determinants of specificity: Comparative analysis can identify critical residues that determine substrate preferences, providing a foundation for rational engineering of signal peptides for biotechnological applications.

Research on signal peptide processing in diverse bacteria, including environmental isolates like C. pinatubonensis, contributes to our fundamental understanding of bacterial envelope biogenesis and can inform applications in synthetic biology and antimicrobial development.

How do genetic organization and regulation patterns in C. pinatubonensis inform our understanding of LspA function?

The genetic organization and regulation patterns observed in C. pinatubonensis provide context for understanding potential LspA function:

  • Distinctive gene clustering: C. pinatubonensis has shown unique gene cluster organization for some protein families, such as the PHA synthase genes, which differ markedly from other bacterial species . This suggests that lipoprotein processing genes might also have distinctive arrangements that reflect their evolutionary history and functional relationships.

  • Substrate-responsive transcriptional regulation: Studies of phaC1 and phaC2 in C. pinatubonensis revealed dramatic differences in transcriptional levels depending on the carbon source (70-fold higher transcription of phaC1 in MNP-grown cells versus 240-fold lower in octanoate-grown cells) . This suggests that lspA expression might similarly respond to specific environmental or nutritional conditions.

  • Functional redundancy with specialization: C. pinatubonensis has demonstrated redundancy in some enzymatic functions (like PHA synthesis) but with differential regulation suggesting specialization for specific conditions . This pattern might extend to lipoprotein processing pathways, with potential implications for lspA function under different growth conditions.

Understanding these patterns can inform experimental design for studying LspA regulation and function in C. pinatubonensis, potentially revealing unique adaptations of lipoprotein processing in this environmentally versatile bacterium.

What are the current knowledge gaps in understanding bacterial LspA proteins that could be addressed using C. pinatubonensis as a model?

Several knowledge gaps in understanding bacterial LspA proteins could be addressed using C. pinatubonensis as a model system:

  • Environmental adaptation: How does LspA function adapt in bacteria that thrive in diverse environments with varying carbon sources? C. pinatubonensis, with its metabolic versatility and ability to utilize aromatic compounds , provides an excellent model to study how lipoprotein processing may be tailored to different ecological niches.

  • Regulatory networks: What regulatory networks control lspA expression in response to environmental conditions? The differential regulation observed for other genes in C. pinatubonensis suggests sophisticated control mechanisms that might reveal new insights into lipoprotein processing regulation.

  • Structural adaptations: How do structural features of LspA vary between pathogenic and non-pathogenic bacteria? Studying LspA from C. pinatubonensis could reveal adaptations specific to environmental bacteria versus pathogens.

  • Inhibitor sensitivity diversity: What molecular determinants explain variation in inhibitor sensitivity across bacterial species? Comparing inhibitor interactions with C. pinatubonensis LspA to those from pathogens could identify key structural differences that influence drug binding.

Addressing these questions would contribute to our fundamental understanding of bacterial envelope biogenesis while potentially informing antimicrobial development strategies.

How might the study of C. pinatubonensis LspA contribute to novel antimicrobial development strategies?

Studying C. pinatubonensis LspA could contribute to novel antimicrobial development strategies in several ways:

  • Comparative structural analysis: Identifying conserved and variable features between LspA enzymes from non-pathogenic (C. pinatubonensis) and pathogenic bacteria could reveal structural elements that could be exploited for selective targeting.

  • Natural resistance mechanisms: Understanding how environmental bacteria like C. pinatubonensis might naturally resist LspA inhibitors could help predict and counter resistance development in pathogens.

  • Novel inhibitory scaffolds: Screening for compounds that inhibit C. pinatubonensis LspA might identify novel scaffolds with unique mechanisms of action that could be developed into new antimicrobials.

  • Structure-guided drug design: Crystal structures of C. pinatubonensis LspA, particularly in complex with inhibitors, could provide additional insights into the 19-atom motif identified in S. aureus LspA-inhibitor complexes , potentially refining our understanding of essential binding interactions.

This research direction aligns with the need for new antibiotics targeting novel mechanisms to address the growing challenge of antimicrobial resistance .

What innovative methodological approaches could advance our understanding of LspA function across bacterial species?

Several innovative methodological approaches could advance our understanding of LspA function across bacterial species, including C. pinatubonensis:

  • Cryo-electron microscopy: Applied to LspA embedded in native-like membrane environments to capture dynamic conformational states during catalysis.

  • Time-resolved structural methods: Such as time-resolved X-ray crystallography or TR-FRET to capture intermediate states in the catalytic cycle.

  • Systems biology approaches: Integrating proteomics, transcriptomics, and metabolomics to map the broader impact of LspA function and inhibition on bacterial physiology.

  • In situ studies: Developing tools for studying LspA activity directly in living bacteria, such as activity-based probes or fluorescent reporter systems.

  • Computational approaches: Advanced molecular dynamics simulations of LspA in membrane environments to understand conformational dynamics and substrate interactions.

  • Synthetic biology: Engineering bacteria with modified lipoprotein processing pathways to dissect the functional roles of specific features of LspA and its substrates.

These approaches would provide complementary insights into LspA function and could reveal species-specific adaptations that inform both fundamental biology and applied antimicrobial development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.