Recombinant Cupriavidus pinatubonensis Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA)

What is the structure and function of mtgA in Cupriavidus pinatubonensis?

Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA) from Cupriavidus pinatubonensis is a 252-amino acid protein that catalyzes glycan chain elongation of the bacterial cell wall. The protein consists of a single domain with glycosyltransferase activity that polymerizes lipid II precursors to form peptidoglycan strands. Similar to other bacterial mtgA proteins, it lacks transpeptidase activity, making it truly "monofunctional" compared to bifunctional penicillin-binding proteins (PBPs) . The protein's amino acid sequence (MPVATRQRSARAAGTAFSPLRWIGFLLGCIVAGVVAMQVYFFLQIAAWQYVAPSSTSFMRAERWRLCGFNVWNCSIDRRWVPYDQISRNLKRAVIASEDADFVNHPGYEIDAMLDAWERNKKRGRVVRGGSTITQQLAKNLFLSSEQHYLRKGQELAITWMLEFWLDKQRIFEIYLNSVE WGEGVFGAEAAAQHYFRTNAGKLGVGQAARLAAALPAPKCFDKKEYCANVRVNFRVKAGIIARRMGAATLPD) contains transmembrane regions and active site residues essential for glycosyltransferase activity .

How does recombinant mtgA from C. pinatubonensis compare to mtgA from other bacterial species?

While mtgA from C. pinatubonensis shares the core glycosyltransferase function with homologs from other species, it possesses distinct sequence characteristics. Research on E. coli mtgA shows that the protein localizes at the division site in cells deficient in PBP1b and contributes to peptidoglycan synthesis . Comparative analysis indicates that C. pinatubonensis mtgA retains the same enzymatic function but may exhibit species-specific interaction partners and regulatory mechanisms. Unlike E. coli mtgA that interacts with divisome proteins PBP3, FtsW, and FtsN , the specific interaction network of C. pinatubonensis mtgA remains to be fully characterized. Evolutionary analysis suggests conservation of key catalytic residues across species while allowing for diversification in regulatory domains.

What are the optimal storage and reconstitution conditions for recombinant C. pinatubonensis mtgA?

For optimal stability and activity, recombinant His-tagged C. pinatubonensis mtgA should be stored as aliquots at -20°C to -80°C in Tris/PBS-based buffer with 6% trehalose at pH 8.0 . Repeated freeze-thaw cycles should be avoided to prevent protein degradation and loss of enzymatic activity. For reconstitution:

• Briefly centrifuge the vial prior to opening to bring contents to the bottom

• Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

• Add glycerol to a final concentration of 5-50% (recommended 50%) for long-term storage

• Store working aliquots at 4°C for up to one week

This protocol maintains protein stability and preserves enzymatic activity for experimental applications.

What are the recommended assays for measuring mtgA glycosyltransferase activity in vitro?

The most reliable method for assessing mtgA glycosyltransferase activity involves monitoring the polymerization of radiolabeled lipid II precursors. The protocol includes:

The reaction is typically conducted at 30°C for 30-60 minutes and terminated by heat inactivation at 100°C for 2 minutes . Products can be separated by thin-layer chromatography or size-exclusion chromatography. Activity is quantified by measuring the percentage of lipid II incorporated into polymeric peptidoglycan. Verification of product identity can be performed through lysozyme digestion, which should completely hydrolyze the polymerized material . A positive control using GFP-MtgA fusion has shown approximately 26% conversion of lipid II compared to 11% in negative controls .

How can I design experiments to investigate mtgA localization in bacterial cells?

To study cellular localization of mtgA, fluorescent protein fusion constructs offer the most direct approach. Based on successful experiments with E. coli mtgA:

• Create an N-terminal or C-terminal GFP-mtgA fusion construct using a flexible linker sequence such as (G₄S)₃ to maintain protein function

• Express the fusion protein in the bacterial strain of interest using an inducible promoter system

• Verify fusion protein activity using in vitro glycosyltransferase assays (see 2.1)

• Visualize localization using fluorescence microscopy throughout different growth phases and cell cycle stages

• Establish co-localization with divisome proteins using dual-fluorescence labeling

For advanced analysis, time-lapse microscopy can track dynamic changes in mtgA localization during cell division. Super-resolution microscopy techniques (PALM/STORM) provide nanometer-scale resolution of protein localization at the division site .

What methods are effective for studying protein-protein interactions involving mtgA?

Multiple complementary approaches should be employed to robustly characterize mtgA interactions:

• Bacterial Two-Hybrid System:

  • Fuse mtgA to CyaT18 domain and potential interaction partners to CyaT25 domain

  • Co-express in an adenylate cyclase-deficient strain (e.g., DHM1)

  • Measure β-galactosidase activity as a readout of protein interaction

  • Include positive controls (known interacting pairs) and negative controls (non-interacting proteins)

• Co-immunoprecipitation:

  • Express epitope-tagged mtgA in the organism of interest

  • Prepare cell lysates under non-denaturing conditions

  • Immunoprecipitate using antibodies against the tag

  • Identify co-precipitating proteins by mass spectrometry or immunoblotting

• Surface Plasmon Resonance:

  • Immobilize purified mtgA on sensor chip

  • Flow potential binding partners over the surface

  • Measure association and dissociation kinetics

  • Calculate binding affinities (KD values)

E. coli mtgA has been shown to interact with PBP3, FtsW, and FtsN, suggesting involvement in the divisome complex. Importantly, the transmembrane segment of PBP3 is required for this interaction .

How does mtgA contribute to peptidoglycan synthesis during cell division compared to bifunctional PBPs?

Unlike bifunctional penicillin-binding proteins (PBPs) that possess both glycosyltransferase and transpeptidase activities, mtgA contributes specifically to glycan chain polymerization without crosslinking peptide stems. Research in E. coli suggests that mtgA collaborates with PBP3 during cell division to synthesize peptidoglycan at new poles .

The division of labor between monofunctional and bifunctional enzymes appears to follow this pattern:

Evidence indicates that mtgA participates in early stages of division, which requires penicillin-insensitive peptidoglycan synthesis before constriction . This is supported by observations that mtgA (along with PBP1c) is insensitive to penicillin and may be responsible for initiating division before penicillin-sensitive proteins take over. While single mtgA or PBP1c mutants show no obvious phenotypic changes, they exhibit a 5-10 fold increase in tetra-pentamuropeptide, suggesting compensatory mechanisms in peptidoglycan metabolism .

What is known about the regulation of mtgA expression and activity in different growth conditions?

While specific data on C. pinatubonensis mtgA regulation is limited, research on homologous proteins suggests several regulatory mechanisms:

• Transcriptional regulation: Expression likely responds to cell wall stress and may be coordinated with other division proteins

• Protein-protein interactions: Activity modulation through divisome protein interactions (PBP3, FtsW, FtsN in E. coli)

• Substrate availability: Regulation through lipid II precursor pools controlled by upstream metabolic pathways

• Spatial regulation: Controlled localization to division sites during specific cell cycle stages

Future research directions should include:

• Transcriptomic analysis of mtgA expression under various stress conditions

• Identification of transcription factors binding the mtgA promoter

• Characterization of post-translational modifications affecting activity

• Investigation of allosteric regulators of enzymatic function

How can CRISPR-Cas9 genome editing be utilized to study mtgA function in C. pinatubonensis?

CRISPR-Cas9 offers powerful approaches for investigating mtgA function through precise genomic modifications:

• Gene deletion strategy:

  • Design sgRNAs targeting the 5' and 3' regions of the mtgA gene

  • Include homology-directed repair templates with selection markers

  • Screen transformants for complete gene deletion

  • Evaluate phenotypic changes in growth, cell morphology, and peptidoglycan composition

• Point mutation introduction:

  • Target conserved catalytic residues predicted from structural models

  • Design repair templates with specific amino acid substitutions

  • Confirm mutations by sequencing

  • Assess effects on enzymatic activity and protein interactions

• Protein tagging approach:

  • Insert fluorescent protein or epitope tag sequences at the C-terminus

  • Maintain the native promoter to preserve physiological expression levels

  • Monitor protein localization and dynamics during growth

• Promoter replacement:

  • Replace native promoter with inducible systems

  • Create conditional expression strains for essential gene studies

  • Investigate dosage effects on cell wall integrity

These genomic modifications should be complemented with phenotypic characterization including growth curves, microscopy, and peptidoglycan composition analysis.

How should researchers analyze peptidoglycan composition changes in mtgA mutant strains?

Analysis of peptidoglycan composition in mtgA mutant strains requires a multi-step analytical approach:

• Peptidoglycan isolation protocol:

  • Grow bacterial cultures to mid-log phase

  • Harvest cells and boil in 4% SDS

  • Wash extensively to remove SDS

  • Treat with pronase to remove covalently attached proteins

  • Wash and lyophilize to obtain purified peptidoglycan

• HPLC analysis of muropeptides:

  • Digest purified peptidoglycan with muramidase

  • Separate muropeptides by reversed-phase HPLC

  • Compare chromatographic profiles between wild-type and mutant strains

  • Quantify relative abundances of monomers, dimers, and higher oligomers

• Mass spectrometry identification:

  • Collect HPLC fractions of interest

  • Analyze by MALDI-TOF or LC-MS/MS

  • Identify specific muropeptide structures

  • Quantify changes in crosslinking, chain length, and modifications

E. coli mtgA mutants show a 5-10 fold increase in tetra-pentamuropeptide ratio , suggesting altered crosslinking patterns. When analyzing C. pinatubonensis mtgA mutants, researchers should specifically monitor:

• Glycan chain length distribution

• Degree of crosslinking

• Presence of unusual muropeptide species

• Cell wall thickness by electron microscopy

What controls and validations are essential when characterizing recombinant mtgA activity?

Rigorous experimental design for mtgA characterization requires these controls and validations:

• Protein quality controls:

  • SDS-PAGE to confirm >90% purity

  • Western blot to verify His-tag presence

  • Circular dichroism to assess proper folding

  • Size-exclusion chromatography to detect aggregation

• Activity assay validations:

  • Positive control with known active glycosyltransferase (e.g., PBP1b)

  • Negative control with heat-inactivated enzyme

  • Dose-response relationship verification

  • Product verification by lysozyme digestion

• Substrate specificity tests:

  • Comparison of different lipid II variants

  • Competition assays with non-radiolabeled substrates

  • Inhibitor sensitivity profiling

• Kinetic parameter determination:

  • Initial velocity measurements at varying substrate concentrations

  • Lineweaver-Burk plot analysis

  • Determination of Km, Vmax, and kcat values

  • Effect of pH, temperature, and ionic strength

These validations ensure that observed activities reflect the true catalytic properties of mtgA rather than experimental artifacts.

How can contradictory findings between in vitro and in vivo studies of mtgA function be reconciled?

Resolving discrepancies between in vitro and in vivo findings requires systematic investigation:

• Physiological context considerations:

  • In vitro conditions may lack critical cellular factors

  • Membrane environment differs from detergent-solubilized conditions

  • Protein concentration in assays may exceed physiological levels

  • Absence of regulatory proteins in reconstituted systems

• Methodological approaches to reconciliation:

  • Use membrane vesicle preparations to bridge pure protein and cellular studies

  • Develop cell-free expression systems retaining native membranes

  • Compare results from multiple complementary techniques

  • Validate in vitro findings with targeted in vivo mutations

• Integrated data analysis framework:

  • Construct mathematical models incorporating both datasets

  • Identify parameters that may explain divergent results

  • Design experiments specifically targeting discrepancies

  • Consider emergent properties from protein complex formation

E. coli studies demonstrated that while the purified Sox system oxidizes sulfide, its rate in vivo is too low to be physiologically relevant , highlighting how in vitro capabilities may not translate to significant in vivo roles. Similar principles may apply to mtgA activity, where cell division site localization likely constrains its function despite broad in vitro substrate utilization.

What protocols should be followed when requesting or sharing mtgA constructs through Material Transfer Agreements?

For effective scientific collaboration involving mtgA constructs:

• Material Transfer Agreement (MTA) best practices:

  • For academic exchanges, follow the Universal Biological Material Transfer Agreement (UBMTA) established by NIH

  • Avoid agreements that grant ownership of subsequent discoveries

  • Ensure MTAs contain clear language on permitted uses

  • Review institutional policies before signing any agreement

• Documentation requirements:

  • Provide comprehensive information on construct design

  • Include full sequence verification data

  • Document expression conditions and purification protocols

  • Share quality control data demonstrating protein activity

• Practical sharing considerations:

  • Ship plasmids on filter paper or as purified DNA

  • Consider providing glycerol stocks for protein expression strains

  • Include detailed protocols for expression and purification

  • Offer troubleshooting guidance for recipient laboratories

The NIH has developed policies advocating the use of a UBMTA when reagents are transferred between academic researchers, with over 100 institutions worldwide agreeing to use this model to simplify reagent sharing . Grant applicants can include costs for distributing reagents in their proposals, which helps overcome logistical hurdles of sharing complex biological materials .

How can researchers design complementation experiments to verify phenotypes associated with mtgA mutations?

Robust complementation strategies to confirm mtgA mutation phenotypes include:

• Plasmid-based complementation:

  • Clone wild-type mtgA under native or inducible promoter

  • Transform into deletion mutant strain

  • Verify expression by Western blot

  • Assess restoration of growth, morphology, and peptidoglycan structure

• Genomic reintegration:

  • Reintroduce wild-type mtgA at native locus or neutral site

  • Maintain native regulatory elements for physiological expression

  • Create marker-free integrants to avoid polar effects

  • Compare with plasmid complementation to rule out copy number effects

• Structure-function validation series:

  • Complement with variants containing point mutations in key residues

  • Test deletion constructs removing specific domains

  • Introduce orthologous mtgA genes from related species

  • Create chimeric proteins to identify functional domains

• Controls to include:

  • Empty vector control

  • Unrelated gene complementation (negative control)

  • Complementation with known functional homolog (positive control)

  • Dose-dependent expression series

This experimental design allows researchers to definitively link phenotypes to mtgA function while providing insight into critical protein domains and residues.

What are promising approaches for developing selective inhibitors of bacterial mtgA for antimicrobial research?

Development of selective mtgA inhibitors represents an important research direction:

• Target-based screening approaches:

  • Develop high-throughput assays monitoring glycosyltransferase activity

  • Screen chemical libraries for compounds inhibiting mtgA but not mammalian glycosyltransferases

  • Perform structure-activity relationship studies on hit compounds

  • Optimize for potency, selectivity, and pharmacological properties

• Structure-based design strategies:

  • Utilize homology models or crystal structures of mtgA

  • Identify unique features of bacterial enzyme active sites

  • Design compounds targeting conserved catalytic residues

  • Employ fragment-based approaches to develop high-affinity ligands

• Natural product exploration:

  • Investigate moenomycin analogs that target glycosyltransferase activity

  • Screen microbial extracts for selective inhibitors

  • Characterize mode of action of identified compounds

  • Develop semi-synthetic derivatives with improved properties

• Evaluation framework:

  • Assess inhibition of isolated enzyme and whole-cell activity

  • Determine specificity against mammalian glycosyltransferases

  • Evaluate resistance development frequency

  • Test efficacy in relevant infection models

This research could yield new classes of antibiotics targeting peptidoglycan synthesis through a mechanism distinct from β-lactams and glycopeptides.

How might comparative genomics inform our understanding of mtgA evolution and functional conservation?

Comparative genomics approaches offer valuable insights into mtgA evolution:

• Phylogenetic analysis framework:

  • Collect mtgA sequences across diverse bacterial phyla

  • Construct maximum likelihood phylogenetic trees

  • Map presence/absence patterns across taxonomic groups

  • Identify horizontal gene transfer events

• Sequence conservation mapping:

  • Perform multiple sequence alignments of mtgA homologs

  • Identify universally conserved residues (likely catalytic)

  • Detect clade-specific residues (functional specialization)

  • Map conservation onto structural models

• Genomic context analysis:

  • Examine gene neighborhood patterns

  • Identify co-evolved gene clusters

  • Detect operon structures and regulatory elements

  • Compare synteny across related species

• Correlation with bacterial cell wall types:

  • Analyze relationship between mtgA sequence features and peptidoglycan composition

  • Identify adaptations in organisms with unusual cell wall structures

  • Correlate evolutionary distance with functional divergence

What potential biotechnological applications exist for recombinant mtgA beyond basic research?

Recombinant mtgA offers several promising biotechnological applications:

• Cell wall engineering:

  • Modification of peptidoglycan structure for enhanced survival in industrial conditions

  • Creation of bacteria with custom cell wall properties for bioremediation

  • Development of strains with increased permeability for protein secretion

  • Engineering of bacteria with altered sensitivity to antibiotics

• Synthetic biology applications:

  • Use as building blocks for artificial cell division systems

  • Integration into minimal cell projects

  • Component in cell-free peptidoglycan synthesis platforms

  • Module in engineered cell morphology control systems

• Diagnostic tool development:

  • Creation of biosensors for peptidoglycan precursors

  • Development of screening platforms for cell wall-targeting antibiotics

  • Design of assays for bacterial detection based on peptidoglycan metabolism

  • Use in research kits for cell wall analysis

• Therapeutic protein engineering:

  • Fusion partner for targeting antimicrobial peptides to the cell wall

  • Component of engineered bacteriophage lysins

  • Template for designing novel cell wall-degrading enzymes

  • Basis for developing antimicrobial nanocomplexes

These applications leverage mtgA's specific interaction with peptidoglycan precursors and its role in bacterial cell wall biosynthesis.

How can multi-omics approaches advance our understanding of mtgA's role in bacterial physiology?

Integrated multi-omics strategies provide a comprehensive framework for characterizing mtgA function:

• Genomics foundation:

  • Whole-genome sequencing to identify mtgA genetic variants

  • Comparative genomics to assess conservation across species

  • Mutational analysis to link sequence to function

  • Metagenomics to explore environmental diversity

• Transcriptomics layer:

  • RNA-seq to measure expression changes in different conditions

  • Identification of co-regulated genes in transcriptional networks

  • Analysis of mtgA expression during cell cycle progression

  • Small RNA interactions affecting post-transcriptional regulation

• Proteomics dimension:

  • Quantitative proteomics to measure mtgA abundance

  • Interactomics to map protein-protein interaction networks

  • Post-translational modification analysis

  • Protein turnover and stability assessment

• Metabolomics integration:

  • Targeted analysis of peptidoglycan precursor pools

  • Metabolic flux analysis of cell wall biosynthesis

  • Measurement of secondary effects on central metabolism

  • Identification of metabolic signatures of mtgA dysfunction

• Data integration framework:

  • Network analysis connecting multi-omics datasets

  • Machine learning approaches to identify predictive signatures

  • Mathematical modeling of peptidoglycan synthesis dynamics

  • Visualization tools for complex data interpretation

This integrated approach would reveal how mtgA functions within the broader context of bacterial physiology and cell wall metabolism.

What are the most significant unresolved questions regarding mtgA function and regulation?

Critical knowledge gaps and future research priorities include:

• Structural biology questions:

  • High-resolution crystal structure of C. pinatubonensis mtgA

  • Conformational changes during catalysis

  • Substrate binding mechanisms

  • Protein-protein interaction interfaces

• Regulatory mysteries:

  • Transcriptional control mechanisms

  • Post-translational modifications affecting activity

  • Allosteric regulation of enzymatic function

  • Coordination with cell cycle progression

• Physiological role uncertainties:

  • Contribution to normal growth versus stress conditions

  • Redundancy with bifunctional PBPs

  • Role in antibiotic resistance mechanisms

  • Importance in environmental adaptation

• Evolutionary questions:

  • Origin and diversification of monofunctional glycosyltransferases

  • Selection pressures driving conservation

  • Functional specialization across bacterial phyla

  • Horizontal transfer patterns