Recombinant Cupriavidus pinatubonensis NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Description

Recombinant Production and Purification

Production Parameters:

ParameterSpecificationSource
Host OrganismE. coli
Purity>90% (SDS-PAGE)
Storage BufferTris-based buffer, 50% glycerol, pH optimized
Storage Conditions-20°C (stable for extended periods); aliquots at 4°C for short-term use

Key Notes:

  • Tagging: While Roseiflexus sp. nuoA is His-tagged , no explicit tag is reported for Cupriavidus variants.

  • Limitations: Repeated freeze-thaw cycles are discouraged due to potential structural instability .

Functional and Research Applications

Role in Complex I:

  • Electron Transfer: Facilitates NADH-to-ubiquinone electron transfer, contributing to proton-pumping activity in the respiratory chain .

  • Subunit Specificity: Unlike other Complex I core subunits, NuoA lacks homologs in non-complex I systems, suggesting a specialized role .

Experimental Utility:

  • ELISA and Assays: Used in immunoassays to study protein-protein interactions or antibody validation .

  • Structural Studies: Recombinant production enables isolation for X-ray crystallography or cryo-EM, though no resolved structures for Cupriavidus nuoA exist .

Comparative Analysis with Homologs

Homologous Subunits:

OrganismKey FeatureSource
E. coliC-terminal cytoplasmic orientation validated via fusion proteins .
Mycobacterium tuberculosisComputed model predicts α-helical structure (pLDDT 84.68) .
Saccharomyces cerevisiaeSingle-subunit NADH dehydrogenase (NDI1) used to bypass complex I defects in mammalian cells .

Functional Insights:

  • Rotenone Resistance: Yeast NDI1 (a single-subunit oxidoreductase) restores NADH-dependent respiration in complex I-deficient human cells, highlighting potential therapeutic applications .

  • Sulfur Oxidation: Cupriavidus strains harbor sqr (sulfide:quinone oxidoreductase) and pdo (polysulfide dioxygenase) genes, suggesting metabolic versatility in sulfide-rich environments .

Research Gaps and Future Directions

  • Structural Elucidation: No experimental structures for Cupriavidus nuoA; reliance on homology models limits mechanistic understanding .

  • Functional Studies: Direct evidence of nuoA’s role in Cupriavidus metabolism (e.g., pollutant degradation or sulfur cycling) remains unexplored .

  • Biotechnological Potential: Leveraging recombinant nuoA for biofuel production or pollutant detoxification warrants investigation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for prioritized development.
Synonyms
nuoA; Reut_A0961; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Cupriavidus necator (strain JMP 134 / LMG 1197) (Ralstonia eutropha (strain JMP 134))
Target Names
nuoA
Target Protein Sequence
MTLEAYFPVLIFIIFGVVLGIALMSIGRILGPNKPDPAKLSPYECGFEAFEDARMKFDVR YYLIAILFILFDLETAFLFPWGVALREIGWPGFIAMGVFLLEFIVGFVYIWKKGALDWE
Uniprot No.

Target Background

Function

NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediaries. In this organism, ubiquinone is believed to be the primary electron acceptor. This redox reaction is coupled with proton translocation; for every two electrons transferred, four protons are translocated across the cytoplasmic membrane, thereby conserving redox energy as a proton gradient.

Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is NADH-quinone oxidoreductase subunit A (nuoA) in Cupriavidus pinatubonensis?

NADH-quinone oxidoreductase subunit A (nuoA) is an essential membrane protein component of the bacterial respiratory chain Complex I. In Cupriavidus pinatubonensis (strain JMP134/LMG 1197), the nuoA protein consists of 119 amino acids and functions as part of the NADH dehydrogenase I complex, which catalyzes the transfer of electrons from NADH to quinones in the respiratory chain. This protein plays a crucial role in energy metabolism and cellular respiration .

How does nuoA from C. pinatubonensis compare to homologous proteins in other bacterial species?

The nuoA protein from C. pinatubonensis shares structural and functional similarities with homologous proteins in other bacterial species, such as Serratia proteamaculans and Cupriavidus necator. Comparative sequence analysis reveals conserved domains characteristic of NADH dehydrogenase subunit A proteins across bacterial species. While the core functional regions remain conserved, species-specific variations occur primarily in non-catalytic regions, potentially reflecting adaptations to different environmental niches and metabolic requirements .

What expression systems are most effective for recombinant nuoA production?

The E. coli expression system has proven most effective for recombinant nuoA production from C. pinatubonensis. When expressing this membrane protein, BL21(DE3) or C43(DE3) E. coli strains are preferred due to their tolerance for membrane protein overexpression. The protein is typically expressed with an N-terminal 10xHis-tag to facilitate purification . For optimal expression, induction with 0.1-0.5 mM IPTG at lower temperatures (16-20°C) for 16-18 hours helps minimize inclusion body formation and maintain proper membrane insertion.

What are the critical factors affecting solubility and stability of recombinant nuoA during purification?

Several critical factors affect the solubility and stability of recombinant nuoA:

FactorOptimal ConditionImpact on Protein
Detergent selectionDDM (n-Dodecyl β-D-maltoside) or LMNGMaintains native conformation
Buffer pH7.5-8.0Prevents aggregation
Salt concentration150-300 mM NaClEnhances stability
Reducing agents1-5 mM DTT or 2-10 mM β-mercaptoethanolPrevents oxidation
Glycerol content10-20%Improves long-term stability
Storage temperature-80°C (long-term); 4°C (short-term)Prevents degradation

Maintaining these conditions throughout purification helps preserve the structural integrity and functional activity of the nuoA protein .

What techniques are most reliable for analyzing the membrane topology of nuoA?

For analyzing the membrane topology of nuoA, a combination of complementary techniques yields the most reliable results:

  • Computational prediction: Programs like TMHMM, HMMTOP, and PredictProtein provide initial topology models based on the amino acid sequence of nuoA (residues 1-119), predicting transmembrane segments .

  • Cysteine scanning mutagenesis: Systematically replacing residues with cysteine and assessing their accessibility to sulfhydryl reagents helps map exposed versus membrane-embedded regions of the protein.

  • Protease protection assays: Limited proteolysis of membrane preparations followed by mass spectrometry identifies proteolytically accessible regions, indicating cytoplasmic or periplasmic exposure.

  • GFP fusion analysis: Creating fusion proteins with GFP at various positions helps determine the cellular localization of different protein segments.

  • Cryo-electron microscopy: For high-resolution structural determination, cryo-EM has become the gold standard for membrane protein complexes like those containing nuoA.

How can researchers effectively characterize the interactions between nuoA and other subunits in the NADH dehydrogenase complex?

To characterize interactions between nuoA and other subunits in the NADH dehydrogenase complex, researchers should employ:

  • Co-immunoprecipitation assays: Using antibodies against tagged nuoA to pull down interacting partners, followed by mass spectrometry identification.

  • Cross-linking mass spectrometry: Chemical cross-linking of proximally located residues followed by mass spectrometry analysis to identify specific interaction sites.

  • Bacterial two-hybrid systems: Modified for membrane proteins to detect direct protein-protein interactions in vivo.

  • Surface plasmon resonance (SPR): For quantitative measurement of binding kinetics between purified nuoA and partner proteins.

  • Blue native PAGE: To analyze intact respiratory complexes and subcomplexes containing nuoA.

  • Hydrogen-deuterium exchange mass spectrometry: To map binding interfaces by detecting changes in deuterium uptake upon complex formation.

These approaches collectively provide a comprehensive map of nuoA's interaction network within the respiratory chain complex.

What are the most effective methods for measuring the enzymatic activity of nuoA-containing NADH dehydrogenase complexes?

The enzymatic activity of nuoA-containing NADH dehydrogenase complexes can be measured through several approaches:

  • NADH oxidation assay: Spectrophotometric monitoring of NADH oxidation at 340 nm in the presence of appropriate electron acceptors like ubiquinone-1.

  • Oxygen consumption measurements: Using oxygen electrodes to measure respiration rates in membrane preparations or reconstituted proteoliposomes.

  • Artificial electron acceptor assays: Employing ferricyanide or dichlorophenolindophenol (DCIP) as artificial electron acceptors with colorimetric detection.

  • Mitochondrial membrane potential assays: Using fluorescent dyes like TMRM or JC-1 to measure the electrochemical gradient generated by the respiratory chain.

  • Native electrophoresis with in-gel activity staining: Separating complexes under native conditions followed by activity-specific staining.

For comprehensive characterization, multiple assays should be performed in parallel, with appropriate controls including specific inhibitors like rotenone.

How can researchers effectively study the role of nuoA in bioplastic production pathways in Cupriavidus species?

While nuoA itself is not directly involved in polyhydroxyalkanoate (PHA) synthesis, as a component of the respiratory chain, it influences cellular energy metabolism, potentially affecting bioplastic production. To study this relationship:

  • Generate nuoA knockout or knockdown strains: Compare PHB accumulation in wild-type versus nuoA-deficient C. pinatubonensis or related species like C. necator under various growth conditions.

  • Metabolic flux analysis: Use 13C-labeled substrates to trace carbon flux through central metabolism and determine how nuoA activity affects the allocation of resources toward PHB synthesis.

  • Respiratory chain analysis: Measure respiration rates and ATP production in relation to PHB accumulation under different oxygen tensions and carbon sources.

  • Comparative transcriptomics/proteomics: Analyze global gene expression and protein abundance changes in response to nuoA manipulation, focusing on PHB synthesis genes (phaA, phaB, phaC) and other metabolic pathways .

  • Two-component system interaction studies: Investigate potential regulatory interactions between nuoA activity and two-component systems known to influence PHB production under metabolic stress conditions .

Researchers have found that manipulating regulatory systems in Cupriavidus can increase PHB productivity by 56% under balanced growth conditions , suggesting that respiratory chain components may play regulatory roles beyond energy generation.

What are the most effective transformation methods for genetic manipulation of Cupriavidus species to study nuoA function?

For genetic manipulation of Cupriavidus species to study nuoA function, several transformation methods have been developed, with electroporation showing particular promise:

  • Optimized electroporation: Recent research has demonstrated that using natively methylated plasmid DNA can increase electroporation efficiency up to 70-fold in Cupriavidus species . This approach involves:

    • Extracting plasmid DNA from Cupriavidus rather than E. coli before Golden Gate assembly

    • Using pBBR1-based replicative plasmids like pMVRha

    • Optimizing electroporation parameters (2.5 kV, 200 Ω, 25 μF)

    • Considering restriction-modification systems that may degrade foreign DNA

  • Triparental mating: An established method using helper strains like E. coli J53/RP4 and cargo strains to transfer plasmid DNA into Cupriavidus species .

  • Biparental mating: Simplified conjugation using E. coli donors containing both helper and transfer functions.

  • Natural transformation: Although less efficient, protocols have been developed for natural competence induction in some Cupriavidus strains.

For nuoA-specific studies, genomic integration using suicide vectors with homologous flanking regions is often preferred for stable expression or gene deletion.

What genomic tools and resources are available for studying nuoA in Cupriavidus pinatubonensis?

Several genomic tools and resources are available for studying nuoA in Cupriavidus pinatubonensis:

  • Complete genome sequence: The genome of C. pinatubonensis (strain JMP134/LMG 1197) has been fully sequenced and annotated, providing the genetic context of nuoA.

  • Bioinformatic prediction tools: Tools like REBASE, DefenseFinder, and PADLOC can identify restriction-modification systems and other defense mechanisms that may affect genetic manipulations .

  • Transposon libraries: RB-TnSeq transposon libraries have been constructed for some Cupriavidus species, allowing for high-throughput functional genomics studies .

  • Expression vectors: Specialized vectors like pMVRha with rhamnose-inducible promoters have been adapted for Cupriavidus species .

  • CRISPR-Cas9 systems: Recent adaptations of CRISPR-Cas9 for Cupriavidus enable precise genome editing.

  • Comparative genomic resources: Databases containing related Cupriavidus species genomes allow for comparative analyses of nuoA and associated genes across species.

  • Transcriptomic datasets: RNA-seq data from various growth conditions helps understand nuoA expression patterns and co-regulated genes.

How does nuoA function differ between Cupriavidus pinatubonensis and related species like Cupriavidus necator?

The function of nuoA in Cupriavidus pinatubonensis and related species like Cupriavidus necator shows both similarities and differences:

  • Core respiratory function: In both species, nuoA serves as a membrane subunit of Complex I in the respiratory chain, participating in electron transfer from NADH to quinones.

  • Metabolic integration: C. necator H16 is known for its remarkable ability to accumulate polyhydroxyalkanoates (PHAs) , while C. pinatubonensis JMP134 is recognized for its capability to degrade aromatic compounds. These metabolic specializations may influence how nuoA activity is integrated with central metabolism.

  • Respiratory chain composition: Subtle differences in the composition and regulation of respiratory complexes exist between the species, potentially affecting nuoA's specific role and interactions.

  • Environmental adaptation: C. pinatubonensis was originally isolated from soil contaminated with 2,4,5-trichlorophenoxyacetic acid, while C. necator strains have different ecological origins, potentially leading to adaptations in respiratory chain components like nuoA.

  • Genetic context: Variation in genes flanking nuoA and operon organization may influence its expression and regulation across species.

Comparative functional studies are needed to fully elucidate these differences, as current literature focuses more on PHB production capabilities than respiratory chain components specifically .

What insights can comparative structural analyses of nuoA across bacterial species provide for functional studies?

Comparative structural analyses of nuoA across bacterial species can provide several valuable insights:

  • Conserved functional domains: Identifying highly conserved regions suggests critical functional importance, highlighting potential catalytic sites or protein-protein interaction interfaces that should be prioritized in mutagenesis studies.

  • Species-specific variations: Structural differences may reflect adaptations to different ecological niches or metabolic requirements, potentially explaining functional variations in electron transfer efficiency or substrate specificity.

  • Evolutionary relationships: Phylogenetic analysis based on structural comparisons can reveal evolutionary trajectories of respiratory chain components and help understand the adaptation of energy metabolism across bacterial lineages.

  • Structure-function correlations: Mapping disease-associated or functionally characterized mutations from model organisms onto the C. pinatubonensis nuoA structure can guide hypothesis-driven research.

  • Drug targeting potential: Understanding structural uniqueness in pathogenic species compared to beneficial environmental bacteria like Cupriavidus can guide the development of selective antimicrobials.

  • Assembly mechanisms: Comparative analysis of interfaces between nuoA and other Complex I subunits across species can reveal conserved versus variable aspects of respiratory complex assembly.

These insights collectively enhance functional studies by providing a structural framework for hypothesis generation and experimental design.

What are the common challenges in expressing and purifying functional recombinant nuoA, and how can they be addressed?

Common challenges in expressing and purifying functional recombinant nuoA include:

ChallengePotential Solutions
Toxicity during overexpression- Use tightly regulated expression systems (e.g., T7-lac) with glucose repression
- Employ C43(DE3) E. coli strain designed for toxic membrane proteins
- Lower induction temperature (16-20°C) and reduce inducer concentration
Poor membrane integration- Co-express molecular chaperones (GroEL/GroES)
- Include proper signal sequences if necessary
- Optimize codon usage for expression host
Aggregation during purification- Screen multiple detergents (DDM, LMNG, LDAO)
- Include glycerol (10-20%) in purification buffers
- Maintain samples at 4°C throughout purification
Low yield- Scale up culture volume
- Optimize cell lysis conditions
- Consider fusion partners that enhance expression
Loss of interacting partners- Co-express with other complex I subunits
- Develop purification strategies for intact subcomplexes
- Consider native-like nanodiscs for reconstitution
Functional instability- Include appropriate cofactors in storage buffer
- Use protease inhibitors throughout purification
- Store as aliquots to avoid freeze-thaw cycles

Addressing these challenges requires systematic optimization of expression and purification protocols specific to the membrane protein nature of nuoA .

What experimental design considerations are important when studying the impact of nuoA mutations on respiratory chain function?

When studying the impact of nuoA mutations on respiratory chain function, several experimental design considerations are crucial:

  • Mutation selection strategy:

    • Target conserved residues identified through multiple sequence alignments

    • Consider both subtle mutations (e.g., conservative substitutions) and more drastic changes

    • Include mutations in predicted transmembrane regions versus loop regions

    • Design controls with mutations in non-conserved regions

  • Expression system considerations:

    • Ensure comparable expression levels between wild-type and mutant proteins

    • Consider inducible systems to control expression timing and level

    • Develop strategies for membrane integration verification

  • Functional assay selection:

    • Employ multiple complementary assays measuring different aspects of respiratory function

    • Include both in vitro (purified protein) and in vivo (whole cell) assays

    • Design assays with appropriate sensitivity to detect subtle functional changes

  • Physiological context:

    • Study effects under different growth conditions (carbon sources, oxygen levels)

    • Examine impacts on bacterial growth, survival, and stress responses

    • Consider connections to other metabolic pathways, such as PHB production

  • Structural validation:

    • Confirm that mutations don't cause gross structural changes (by CD spectroscopy or limited proteolysis)

    • Consider the impacts on interactions with other subunits

  • Controls and statistical considerations:

    • Include appropriate positive and negative controls

    • Perform sufficient biological and technical replicates

    • Apply appropriate statistical tests for significance

Following these considerations ensures robust experimental design that can confidently attribute observed phenotypes to specific nuoA functions rather than secondary effects.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.