Recombinant Cupriavidus pinatubonensis NADH-quinone oxidoreductase subunit K (nuoK)

What is the NADH-quinone oxidoreductase subunit K (nuoK) and what is its function in Cupriavidus pinatubonensis?

NADH-quinone oxidoreductase subunit K (nuoK) is a critical component of respiratory complex I in C. pinatubonensis. As observed in related species, nuoK functions as a membrane-embedded subunit that forms part of the proton-translocating machinery. This protein typically contains hydrophobic transmembrane helices that contribute to the formation of proton channels essential for the conversion of redox energy to a proton gradient. In C. pinatubonensis, like its close relative C. taiwanensis, nuoK plays a crucial role in energy conservation during chemolithotrophic and heterotrophic growth, helping couple NADH oxidation to quinone reduction while pumping protons across the membrane .

What is the taxonomic classification and physiological context of Cupriavidus pinatubonensis?

Cupriavidus pinatubonensis belongs to the genus Cupriavidus within Betaproteobacteria. The species was originally isolated from volcanic mudflow deposits derived from the 1991 eruption of Mt. Pinatubo in the Philippines. C. pinatubonensis is characterized as a hydrogen-oxidizing, facultatively chemolithotrophic bacterium with aerobic metabolism. Morphologically, it appears as Gram-negative, non-sporulating, peritrichously flagellated rods. The species has a G+C content ranging from 65.2 to 65.9 mol% and possesses ubiquinone Q-8 as its major isoprenoid quinone. Notably, the strain previously known as Ralstonia sp. LMG 1197 (JMP 134) has been reclassified as C. pinatubonensis . This taxonomic context is important for researchers studying the evolutionary adaptations of respiratory complexes in diverse bacterial lineages.

How should recombinant nuoK from C. pinatubonensis be expressed for optimal yield and functionality?

Optimal expression of recombinant nuoK from C. pinatubonensis requires careful consideration of several factors based on experience with similar membrane proteins:

• Expression system selection: E. coli is a suitable heterologous host for nuoK expression, as demonstrated with related proteins from Cupriavidus species. BL21(DE3) or C41/C43(DE3) strains are recommended for membrane protein expression .

• Vector design: Incorporation of an N-terminal His-tag facilitates purification while minimizing interference with membrane insertion. This approach has been successful with the related C. taiwanensis nuoK protein, which achieved >90% purity using this strategy .

• Growth conditions: Expression should be conducted at lower temperatures (16-20°C) after induction to reduce inclusion body formation.

• Induction parameters: Lower IPTG concentrations (0.1-0.5 mM) and extended expression times (16-20 hours) generally yield better results for membrane proteins.

• Media supplements: Addition of glucose (0.5%) can help reduce basal expression, while glycerol (0.5%) can improve membrane protein folding.

For functional studies, co-expression with other complex I components may be necessary, as demonstrated with the successful heterologous production of hydrogenases from Cupriavidus necator in E. coli .

What purification protocol yields the highest purity and activity for recombinant nuoK?

Based on successful approaches with related proteins, the following purification protocol is recommended for recombinant nuoK from C. pinatubonensis:

• Membrane preparation: Harvest cells and disrupt by sonication or high-pressure homogenization in buffer containing protease inhibitors. Collect membrane fraction by ultracentrifugation (100,000×g, 1 hour).

• Solubilization: Solubilize membranes using mild detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin at 1% concentration, in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, and 10% glycerol.

• Affinity chromatography: Load solubilized protein onto Ni-NTA resin, wash extensively, and elute with an imidazole gradient (50-300 mM). For His-tagged constructs similar to those used with C. taiwanensis nuoK, this approach has achieved >90% purity as determined by SDS-PAGE .

• Size exclusion chromatography: Further purify by gel filtration to remove aggregates and non-specific binding proteins.

• Storage: Maintain in buffer containing 50 mM Tris-HCl pH 8.0, 150 mM NaCl, 0.05% DDM, and 10% glycerol. For long-term storage, add 50% glycerol and store at -80°C. Avoid repeated freeze-thaw cycles as they significantly reduce protein stability .

The addition of 6% trehalose to storage buffers has been shown to improve stability of similar proteins, as noted for the C. taiwanensis nuoK preparation .

What structural analysis methods are most informative for understanding nuoK function?

Multiple complementary approaches are recommended for structural characterization of recombinant nuoK:

• Cryo-electron microscopy: The most powerful method for determining the structure of membrane proteins within larger complexes. For nuoK in particular, this can reveal its spatial orientation relative to other complex I subunits.

• X-ray crystallography: While challenging for isolated membrane proteins, this approach can provide high-resolution structural data if the protein can be crystallized, potentially using lipidic cubic phase methods.

• NMR spectroscopy: Solution NMR is suitable for determining dynamic properties and ligand interactions, particularly for specific domains or peptides derived from nuoK.

• Circular dichroism (CD): Provides valuable information about secondary structure content and stability under various conditions.

• Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Useful for probing solvent accessibility and conformational changes upon interaction with other subunits.

• Cross-linking coupled with mass spectrometry: Helps identify interaction interfaces between nuoK and neighboring subunits within the complex.

The amino acid sequence analysis of related nuoK proteins reveals highly hydrophobic regions consistent with multiple transmembrane helices. For example, the C. taiwanensis nuoK sequence (MLSLAHFLVLGAILFAISIVGIFLNRKNVIVLLMAIELMLLAVNINFVAFSHYLGDLAGQVFVFFILTVAAAESAIGLAILVVLFRNLDTINVDDLDTLKG) shows patterns typical of membrane-spanning domains .

What assays can reliably measure enzymatic activity of recombinant nuoK within the NADH-quinone oxidoreductase complex?

As nuoK functions as part of the larger complex I, activity assays typically require reconstitution or co-expression with other complex components:

For all these assays, proper controls are essential, including samples lacking critical subunits or containing known inhibitors of complex I (rotenone, piericidin A).

How does nuoK contribute to the metabolic flexibility of C. pinatubonensis?

The nuoK subunit, as part of complex I, plays a crucial role in the remarkable metabolic versatility of C. pinatubonensis:

• Chemolithotrophic growth: During hydrogen oxidation, complex I (including nuoK) participates in energy conservation by coupling electron transfer to proton pumping. C. pinatubonensis, like other Cupriavidus species, can grow as a hydrogen-oxidizing chemolithotroph, where efficient energy coupling is essential .

• Heterotrophic metabolism: During growth on organic carbon sources, complex I oxidizes NADH generated from central carbon metabolism, feeding electrons into the respiratory chain.

• Adaptation to stress conditions: The efficient energy conservation provided by a functional complex I helps C. pinatubonensis adapt to challenging environments, such as the volcanic mudflow deposits from which it was isolated .

• Sulfur metabolism: In C. pinatubonensis JMP134, there are interactions between different electron transport systems, including those involved in sulfur compound oxidation. The Sox system for thiosulfate oxidation and mechanisms for dealing with sulfane sulfur accumulation highlight the complexity of redox processes in this organism .

Studies in C. pinatubonensis JMP134 have shown how alternative electron transport pathways help alleviate oxidative stress, such as the role of persulfide dioxygenase and glutathione in sulfur compound metabolism . These mechanisms likely interact with the primary respiratory chain containing nuoK.

How can site-directed mutagenesis be utilized to investigate critical residues in nuoK function?

Site-directed mutagenesis provides powerful insights into structure-function relationships in nuoK through the following approach:

• Target identification: Based on sequence alignments with homologous proteins, identify conserved residues likely to be involved in proton translocation or subunit interactions. The amino acid sequence from C. taiwanensis nuoK can serve as a valuable reference .

• Mutation design strategy:

  • Replace charged residues (Asp, Glu, Lys, Arg) in predicted transmembrane regions to neutrally charged ones to assess their role in proton translocation

  • Substitute conserved hydrophobic residues with alanine to evaluate structural integrity

  • Create chimeric constructs by swapping regions between nuoK from different Cupriavidus species

• Expression and activity comparison: Express wildtype and mutant proteins under identical conditions and compare:

  • Expression levels and membrane integration

  • Complex assembly efficiency

  • NADH oxidation rates

  • Proton pumping efficiency

  • Growth complementation in knockout strains

• Structural validation: Confirm the structural impact of mutations using CD spectroscopy to verify that observed functional changes are not due to gross structural perturbations.

This approach has been successfully applied to related hydrogenase systems, where heterologous expression in E. coli allowed functional characterization of critical components .

What approaches can elucidate the interaction of nuoK with other subunits of the NADH-quinone oxidoreductase complex?

Several complementary techniques can reveal nuoK's interactions within the complex:

• Co-immunoprecipitation: Using antibodies against tagged nuoK to pull down interacting partners, followed by mass spectrometry identification.

• Bacterial two-hybrid system: Particularly useful for membrane protein interactions, this genetic approach can screen for direct interactions between nuoK and other subunits.

• Cross-linking coupled with mass spectrometry: Chemical cross-linkers of various arm lengths can covalently link nuoK to neighboring subunits, with subsequent MS analysis revealing interaction points. This approach is particularly valuable for transmembrane domains.

• Genetic suppressor analysis: Identify suppressors of nuoK mutations that restore function, often revealing functional interactions with other subunits.

• Co-expression studies: Systematic co-expression of nuoK with various combinations of other complex I subunits can reveal which components are necessary for stable membrane integration and activity.

The successful heterologous production of related multi-subunit complexes from Cupriavidus species in E. coli demonstrates the feasibility of studying such interactions in a controlled system .

What are common pitfalls in heterologous expression of membrane proteins like nuoK and how can they be overcome?

Membrane protein expression presents several challenges that can be addressed through specific strategies:

When expressing nuoK specifically, consider that related Cupriavidus taiwanensis nuoK was successfully produced with N-terminal His-tags and showed high purity (>90%) using nickel affinity chromatography . The successful expression of hydrogenases from Cupriavidus species in E. coli also provides useful methodological insights for respiratory complex components .

How can researchers verify the structural integrity and proper folding of recombinant nuoK?

Multiple analytical approaches can confirm proper folding and structural integrity:

• Detergent screening by size-exclusion chromatography (SEC): Monodisperse elution profiles indicate properly folded protein, while aggregation suggests misfolding. Test multiple detergents including DDM, LMNG, and digitonin.

• Thermal shift assays: Using differential scanning fluorimetry (DSF) with hydrophobic dyes like SYPRO Orange to determine melting temperatures under different buffer conditions.

• Limited proteolysis: Properly folded membrane proteins show characteristic resistance patterns to proteases like trypsin or chymotrypsin.

• Circular dichroism (CD) spectroscopy: For nuoK, expect high alpha-helical content typical of membrane proteins, with characteristic minima at 208 and 222 nm.

• Functional reconstitution: Ultimate verification comes from successful incorporation into proteoliposomes with demonstrable activity.

• Blue-native PAGE: Analysis of complex formation with partner subunits, which indicates proper folding and assembly competence.

The ability to achieve >90% purity in related nuoK preparations suggests that the protein can be stably produced when appropriate expression and purification methods are employed .

What controls are essential when performing functional assays with recombinant nuoK?

Robust functional assays require several critical controls:

• Negative controls:

  • Inactive mutant version of nuoK (e.g., with key residues mutated)

  • Samples treated with specific complex I inhibitors (rotenone, piericidin A)

  • Proteoliposomes lacking nuoK but containing other complex components

  • Heat-denatured protein samples

• Positive controls:

  • Purified native complex I (if available)

  • Well-characterized homologous protein from related species

  • Established proton-pumping membrane protein (e.g., bacteriorhodopsin) for proteoliposome integrity verification

• Technical validation:

  • Protein-free liposomes to establish baseline proton leakage

  • Calibration with known protonophores (CCCP, valinomycin/nigericin)

  • Internal pH standards for fluorescent measurements

  • Parallel assays using different methodologies to confirm results

For comparative studies, the JMP134 strain of C. pinatubonensis can serve as a reference point for wild-type activity levels, especially when investigating related metabolic functions .

How does nuoK from C. pinatubonensis compare functionally with homologous proteins from other bacterial species?

Comparative analysis reveals important functional conservation and specialization:

• Sequence conservation patterns: The nuoK sequence from Cupriavidus species shows high conservation in transmembrane regions, particularly in residues facing the protein interior. The 101-amino acid sequence from C. taiwanensis nuoK (MLSLAHFLVLGAILFAISIVGIFLNRKNVIVLLMAIELMLLAVNINFVAFSHYLGDLAGQVFVFFILTVAAAESAIGLAILVVLFRNLDTINVDDLDTLKG) provides a useful reference point for comparison .

• Functional adaptation: In facultative chemolithotrophs like C. pinatubonensis, nuoK likely has adaptations for efficient energy conservation during both heterotrophic and autotrophic growth, reflecting the organism's metabolic versatility as a hydrogen-oxidizing bacterium .

• Interaction with alternative electron transport systems: C. pinatubonensis JMP134 possesses systems for sulfur compound metabolism that interact with the main respiratory chain. The presence of a complete Sox system and mechanisms to handle sulfane sulfur suggests complex redox regulation that may influence electron flow through complex I containing nuoK .

• Evolutionary context: As a member of Betaproteobacteria isolated from volcanic environments, C. pinatubonensis nuoK may have adaptations for functioning under unique geochemical conditions compared to nuoK from neutrophilic or acidophilic bacteria .

• Cross-species functionality: The observation that heterologous hydrogenases from Cupriavidus necator can be functionally expressed in E. coli suggests conservation of assembly factors and electron transport components, which may extend to nuoK functionality across species boundaries .

When designing experiments to test functional conservation, researchers should consider both in vitro activity measurements and in vivo complementation studies using genetic knockouts of homologous genes.

What insights can genomic and phylogenetic analyses provide about nuoK evolution in Cupriavidus species?

Genomic and phylogenetic analyses offer valuable evolutionary perspectives:

• Gene synteny analysis: Examining the organization of nuo operons across Cupriavidus species can reveal conservation patterns and potential horizontal gene transfer events. The JMP134 strain of C. pinatubonensis serves as a well-characterized reference genome .

• Selection pressure mapping: Calculating dN/dS ratios across nuoK sequences from multiple Cupriavidus species can identify residues under purifying or positive selection.

• Correlation with ecological niches: C. pinatubonensis was isolated from volcanic environments , while other Cupriavidus species inhabit diverse niches including contaminated soils and plant-associated habitats. These ecological differences may be reflected in nuoK adaptations.

• Co-evolution with partner subunits: Correlation analyses of evolutionary rates between nuoK and other complex I subunits can identify co-evolving residues that maintain structural and functional interactions.

• Horizontal gene transfer assessment: The G+C content of nuoK (65.2-65.9 mol% for C. pinatubonensis ) compared to the genome average can suggest whether the gene was acquired horizontally.

• Functional divergence timing: Molecular clock analyses calibrated with geological events (such as the Mt. Pinatubo eruption in 1991, from which C. pinatubonensis was isolated ) can estimate when functional specializations occurred.

These analyses can help researchers understand how nuoK has evolved to support the metabolic versatility of Cupriavidus species in different environments, informing experimental approaches to study structure-function relationships.

What emerging technologies show promise for advancing research on nuoK and related respiratory complex components?

Several cutting-edge technologies offer new opportunities for nuoK research:

• Cryo-electron tomography: Allows visualization of respiratory complexes in their native membrane environment, potentially revealing nuoK orientation and interactions not captured in purified systems.

• Single-molecule FRET: Can measure conformational changes in nuoK during the catalytic cycle, providing insights into the coupling mechanism between electron transfer and proton pumping.

• Nanodiscs technology: Provides a more native-like membrane environment than detergent micelles for structural and functional studies of nuoK and assembled complexes.

• Microfluidic respiratory measurements: Enables real-time monitoring of respiratory activity in live bacterial cells with various genetic modifications to nuoK.

• In-cell NMR: May allow detection of structural changes in nuoK within intact cells under different metabolic conditions.

• CRISPR interference (CRISPRi): Provides tunable repression of nuoK expression, allowing dose-dependent studies of its importance in various growth conditions.

• AlphaFold2 and related AI structure prediction tools: Can generate high-confidence structural models of nuoK and its interactions with other subunits, guiding experimental design.

The interdisciplinary integration of these technologies with established biochemical approaches will provide more comprehensive understanding of nuoK function in the context of C. pinatubonensis metabolism.

How might research on nuoK from C. pinatubonensis contribute to broader understanding of bacterial energy metabolism?

Research on C. pinatubonensis nuoK has several potential broader impacts:

• Metabolic flexibility mechanisms: Understanding how nuoK contributes to energy conservation during both chemolithotrophic and heterotrophic growth can reveal principles of metabolic switching in facultative chemolithotrophs .

• Adaptation to extreme environments: As C. pinatubonensis was isolated from volcanic deposits , studying its energy conservation mechanisms may reveal adaptations for survival in geochemically challenging environments.

• Cross-talk between respiratory systems: The interaction between complex I (containing nuoK) and alternative electron transport systems, such as those involved in sulfur metabolism in C. pinatubonensis JMP134 , exemplifies regulatory mechanisms coordinating different respiratory pathways.

• Evolutionary plasticity of respiratory complexes: Comparative analysis of nuoK across Cupriavidus species can illuminate how respiratory complexes evolve in response to different ecological pressures.

• Applications in synthetic biology: The successful heterologous expression of Cupriavidus respiratory components in E. coli suggests potential for engineering novel electron transport pathways for biotechnological applications.

• Bioremediation applications: C. pinatubonensis strains are known for their ability to degrade environmental pollutants, a process requiring efficient energy conservation through respiratory complexes containing nuoK.

By advancing understanding of these fundamental aspects of bacterial energy metabolism, research on C. pinatubonensis nuoK contributes to both basic science knowledge and potential biotechnological applications.