Recombinant Cupriavidus taiwanensis Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Genomic Context and Evolution

C. taiwanensis plsY is part of a conserved symbiotic gene cluster in nitrogen-fixing Cupriavidus strains. Comparative genomics reveals:

Genomic FeatureDetail
Symbiotic PlasmidShared with C. nantongensis and C. neocaledonicus
Sequence Identity>99.97% across C. taiwanensis strains (e.g., STM 6018 vs. LMG19424)
Horizontal Gene TransferSymbiotic plasmids likely acquired via HGT in beta-rhizobia

While C. taiwanensis is symbiotic, recent studies highlight novel Cupriavidus symbionts (e.g., C. necator, C. pinatubonensis) in Uruguayan Mimosa, expanding the genus’ diversity .

Applications in Research

The recombinant enzyme is used for:

  1. Lipid Metabolism Studies: Investigating membrane phospholipid biosynthesis.

  2. Enzymatic Assays: Kinetic analysis of acyltransferase activity.

  3. Protein Engineering: Structural studies leveraging His-tag purification .

Handling Recommendations:

  • Avoid repeated freeze-thaw cycles.

  • Store at -20°C/-80°C; aliquot with 50% glycerol for long-term stability .

Research Gaps and Future Directions

  • Structural Studies: No crystal structures exist for C. taiwanensis plsY; homology modeling is needed.

  • Symbiotic Role: Potential links between lipid metabolism and nitrogen fixation in Cupriavidus remain unexplored.

  • Biotechnological Potential: Exploring plsY for biofuel production or antimicrobial target development.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your desired format in the order notes and we will fulfill your request.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, the shelf life for liquid form is 6 months at -20°C/-80°C, while the shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple use, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its inclusion.
Synonyms
plsY; RALTA_A0543; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-202
Protein Length
full length protein
Species
Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CIP 107171 / LMG 19424 / R1) (Ralstonia taiwanensis (strain LMG 19424))
Target Names
plsY
Target Protein Sequence
MANLLFALAAYLIGSVSFAVVVSKLMGLPDPHSYGSGNPGATNVLRTGNKKAAILTLIGD ALKGWLAVWLAARFGPAHGLNDTGLAMVALAVFLGHLFPVFHRFAGGKGVATAAGILLAI DPILGLGTLATWLIIAFFFRYSSLAALVAAIFAPFFHVLMNGVDVMAGAIFVISVLLIAR HRQNIAKLLAGKESRIGEKKKV
Uniprot No.

Target Background

Function
Catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P), resulting in the formation of lysophosphatidic acid (LPA). This enzyme utilizes acyl-phosphate as the fatty acyl donor, but not acyl-CoA or acyl-ACP.
Database Links
Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Cupriavidus taiwanensis Glycerol-3-phosphate acyltransferase (plsY) and what is its role in bacterial metabolism?

Cupriavidus taiwanensis Glycerol-3-phosphate acyltransferase (plsY) is a key enzyme involved in the first and rate-limiting step of glycerolipid synthesis in bacteria. It catalyzes the acylation of glycerol-3-phosphate to form lysophosphatidic acid, which is a precursor for phospholipid and triglyceride synthesis. In Cupriavidus taiwanensis, plsY is encoded by the plsY gene (also known as RALTA_A0543) and plays a crucial role in membrane lipid biosynthesis .

The enzyme belongs to the acyl-phosphate--glycerol-3-phosphate acyltransferase family and is instrumental in maintaining bacterial membrane integrity and function. Unlike mammalian GPAT enzymes which exist in multiple isoforms (GPAT1-4) with varying subcellular localizations, bacterial plsY is typically membrane-bound and essential for bacterial viability and growth .

What expression systems are recommended for producing recombinant Cupriavidus taiwanensis plsY?

For optimal expression of recombinant Cupriavidus taiwanensis plsY, Escherichia coli-based expression systems are typically recommended due to their ease of manipulation, rapid growth, and high protein yields. The commercially available recombinant plsY is expressed in E. coli with an N-terminal His-tag to facilitate purification .

Methodologically, researchers should consider the following approach:

  • Clone the plsY gene (1-202 amino acids) into an expression vector with an appropriate promoter (e.g., T7 or tac)

  • Include a His-tag or other affinity tag for purification purposes

  • Transform the construct into an E. coli expression strain (BL21(DE3) or similar)

  • Optimize expression conditions (temperature, IPTG concentration, induction time)

  • Extract and purify using nickel affinity chromatography

  • Verify protein identity and integrity through SDS-PAGE and Western blotting

This approach typically yields recombinant protein with greater than 90% purity, suitable for enzymatic and structural studies .

What are the optimal storage and handling conditions for maintaining plsY enzyme activity?

To maintain optimal enzyme activity, recombinant Cupriavidus taiwanensis plsY should be handled according to these methodological guidelines:

  • Store the lyophilized protein powder at -20°C to -80°C until ready for use

  • Upon receipt, briefly centrifuge the vial to bring contents to the bottom before opening

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (optimally 50%) to prevent freeze-thaw damage

  • Aliquot the reconstituted protein to minimize repeat freeze-thaw cycles

  • For long-term storage, keep aliquots at -20°C to -80°C

  • For working stocks, store at 4°C for up to one week

  • Use Tris/PBS-based buffer (pH 8.0) containing 6% trehalose for dilutions

It's crucial to note that repeated freeze-thaw cycles significantly reduce enzyme activity and should be avoided. Additionally, the enzyme should be handled on ice when in solution to minimize degradation.

How can I optimize the enzymatic assay conditions for measuring recombinant Cupriavidus taiwanensis plsY activity?

Optimizing enzymatic assay conditions for recombinant Cupriavidus taiwanensis plsY requires careful consideration of multiple parameters that affect enzyme kinetics. Here's a methodological approach:

  • Buffer composition: Start with 50 mM Tris-HCl (pH 7.5-8.0) containing 100 mM NaCl and 10 mM MgCl₂ as magnesium is typically required as a cofactor for acyltransferase activity.

  • pH optimization: Test activity across a pH range (7.0-9.0) to determine optimal pH, as bacterial GPATs typically show maximum activity in slightly alkaline conditions.

  • Temperature: Evaluate enzyme activity at temperatures ranging from 25°C to 45°C, with 37°C often being optimal for bacterial enzymes.

  • Substrate concentration optimization: Determine Km values for both glycerol-3-phosphate and acyl-CoA substrates by varying concentrations:

    • Glycerol-3-phosphate: 0.1-10 mM

    • Acyl-CoA: 1-100 μM (test various chain lengths, as substrate preference is important)

  • Detection method: Use either:

    • Radiometric assay with [¹⁴C]-labeled glycerol-3-phosphate

    • Spectrophotometric assay measuring CoA-SH release

    • HPLC-based methods to detect lysophosphatidic acid formation

  • Data analysis: Plot enzyme kinetics using Michaelis-Menten and Lineweaver-Burk plots to determine Vmax, Km, and catalytic efficiency.

A typical reaction mixture might contain: 50 mM Tris-HCl (pH 8.0), 100 mM NaCl, 10 mM MgCl₂, 0.5-5 μg purified enzyme, 0.1-0.5 mM acyl-CoA, and 0.5-2 mM glycerol-3-phosphate in a total volume of 100 μL. Incubate at 37°C for 10-30 minutes before stopping the reaction and measuring product formation .

What approaches can be used to investigate substrate specificity of Cupriavidus taiwanensis plsY compared to GPATs from other bacterial species?

Investigating substrate specificity of Cupriavidus taiwanensis plsY requires a systematic comparative approach:

  • Acyl-CoA chain length preference: Test activity with a panel of acyl-CoA substrates varying in chain length (C8-C20) and saturation (saturated vs. unsaturated). Quantify relative activity with each substrate under identical reaction conditions.

Acyl-CoA SubstrateRelative Activity (%)Km (μM)Vmax (nmol/min/mg)
Palmitoyl-CoA (C16:0)100 (reference)TBDTBD
Stearoyl-CoA (C18:0)TBDTBDTBD
Oleoyl-CoA (C18:1)TBDTBDTBD
Arachidonoyl-CoA (C20:4)TBDTBDTBD
Octanoyl-CoA (C8:0)TBDTBDTBD
  • Comparative kinetics: Determine kinetic parameters (Km, Vmax, kcat) for each substrate and calculate catalytic efficiency (kcat/Km). Compare these values with published data for other bacterial GPATs.

  • Site-directed mutagenesis: Identify conserved residues in the active site through sequence alignment with other bacterial plsY enzymes. Introduce point mutations to assess their impact on substrate preference.

  • Structural modeling: Use homology modeling and molecular docking to predict substrate binding modes and interactions within the active site.

  • Complementation studies: Express C. taiwanensis plsY in E. coli or other bacterial strains with GPAT mutations to assess functional complementation with different substrates.

  • Competitive inhibition assays: Use structurally modified acyl-CoA analogs to probe binding site characteristics.

This methodological framework allows researchers to create a comprehensive substrate specificity profile for C. taiwanensis plsY and make meaningful comparisons with other bacterial GPATs .

How does the function of plsY in Cupriavidus taiwanensis relate to the organism's adaptation to diverse environmental conditions?

The function of plsY in Cupriavidus taiwanensis plays a critical role in the organism's adaptation to diverse environmental conditions through several mechanisms:

  • Membrane lipid composition adjustment: As the initial enzyme in phospholipid biosynthesis, plsY helps modulate membrane composition in response to environmental stressors. Cupriavidus species are known to inhabit diverse ecological niches, from soil to plant nodules to heavy metal contaminated environments .

  • Symbiotic relationships: C. taiwanensis forms nitrogen-fixing symbiotic relationships with leguminous plants, particularly Mimosa species. The membrane lipid composition, regulated in part by plsY activity, is crucial for establishing and maintaining bacteroid structures within plant nodules. Research shows that C. taiwanensis strains like STM 6018 and LMG 19424T are specifically adapted to nodulate Mimosa pudica, suggesting co-evolution of metabolic systems .

  • Heavy metal tolerance: Cupriavidus species are known for their resistance to heavy metals, and membrane lipid composition plays a role in this tolerance. plsY activity may adjust in response to heavy metal exposure, modifying membrane permeability and fluidity.

  • Metabolic integration: plsY function is integrated with other metabolic pathways. For instance, in the related organism Cupriavidus basilensis, modifications to two-component regulatory systems affect polyhydroxybutyrate (PHB) production . Similar regulatory networks may connect plsY activity to stress responses and carbon storage mechanisms in C. taiwanensis.

Methodologically, researchers investigating these adaptations should consider:

  • Comparing plsY expression and activity under various growth conditions (different carbon sources, symbiotic vs. free-living, presence of heavy metals)

  • Analyzing the lipid profiles of C. taiwanensis membranes in different environments

  • Investigating regulatory elements that control plsY expression in response to environmental cues

This research approach provides insights into how plsY contributes to the remarkable environmental adaptability of C. taiwanensis .

What are the key considerations when designing experiments to study the role of plsY in phospholipid biosynthesis in Cupriavidus taiwanensis?

When designing experiments to study plsY's role in phospholipid biosynthesis in Cupriavidus taiwanensis, researchers should consider the following methodological approaches:

  • Gene expression manipulation strategies:

    • Construct an inducible expression system to control plsY expression levels

    • Develop a CRISPR/Cas9-based knockout or knockdown system (if plsY is not essential)

    • Design dominant negative mutants by site-directed mutagenesis of catalytic residues

    • Create conditional mutants if complete knockout is lethal

  • Lipidomic analysis pipeline:

    • Establish standardized lipid extraction protocols optimized for bacterial membranes

    • Employ LC-MS/MS for comprehensive phospholipid profiling

    • Develop methods to track incorporation of isotope-labeled precursors into phospholipids

    • Compare lipid profiles under different growth conditions and genetic manipulations

  • In vivo vs. in vitro approaches:

    • In vitro: Purify recombinant plsY to study direct enzymatic activity

    • In vivo: Monitor phospholipid synthesis in living cells with altered plsY expression

    • Combine both approaches to distinguish direct enzymatic effects from cellular compensatory mechanisms

  • Essential controls and variables:

    • Include wild-type C. taiwanensis as positive control

    • Use enzyme-dead plsY mutants as negative controls

    • Vary carbon sources to test substrate availability effects

    • Manipulate growth conditions to mimic environmental stresses

  • Integration with other metabolic pathways:

    • Design experiments to examine cross-talk between phospholipid synthesis and other pathways like PHB production

    • Consider impact on membrane-bound proteins and transporters

    • Evaluate effects on cell division and morphology

A comprehensive experimental design would include time-course studies of phospholipid synthesis under varying plsY expression levels, combined with transcriptomic and proteomic analyses to identify compensatory mechanisms and regulatory networks .

How can I establish a reliable system for heterologous expression and purification of Cupriavidus taiwanensis plsY for structural studies?

Establishing a reliable system for heterologous expression and purification of Cupriavidus taiwanensis plsY for structural studies requires a methodical approach addressing challenges specific to membrane proteins:

  • Expression vector design:

    • Clone the full-length plsY gene (1-202 aa) with codon optimization for the expression host

    • Include fusion tags: N-terminal His₆-tag for purification and optionally a solubility enhancer tag (MBP, SUMO, or Trx)

    • Incorporate a precision protease cleavage site between tags and the target protein

    • Select an appropriate promoter system (T7 for high expression, arabinose-inducible for tighter control)

  • Expression host selection:

    • E. coli strains optimized for membrane protein expression (C41(DE3), C43(DE3), or Lemo21(DE3))

    • Consider Cupriavidus-related expression hosts for native-like membrane environment

    • Test expression in cell-free systems for difficult-to-express constructs

  • Optimization of expression conditions:

    • Temperature: Test reduced temperatures (16-25°C) for proper folding

    • Inducer concentration: Titrate IPTG (0.1-1.0 mM) or other inducers

    • Duration: Test shorter induction periods (3-6 hours) vs. overnight

    • Media: Compare rich media (TB, 2XYT) vs. defined media for structural studies

  • Membrane protein extraction and solubilization:

    • Test multiple detergents for optimal solubilization:

      • Mild detergents: DDM, LMNG, or digitonin

      • Stronger detergents: LDAO or OG

    • Alternative: Consider nanodisc or amphipol reconstitution for structural studies

  • Purification strategy:

    • Two-step purification minimum:

      • IMAC (Ni-NTA) affinity chromatography

      • Size exclusion chromatography

    • Optional: Ion exchange chromatography as an intermediate step

  • Quality control checkpoints:

    • SDS-PAGE and Western blot to confirm identity and purity

    • SEC-MALS to assess homogeneity and oligomeric state

    • Thermal shift assays to optimize buffer conditions

    • Activity assays to confirm functional state

  • Crystallization or Cryo-EM preparation:

    • For crystallization: Perform limited proteolysis to identify stable domains

    • For Cryo-EM: Optimize sample concentration and grid preparation

A typical high-yield preparation would start with 6-10 liters of bacterial culture, with expected final yields of 1-5 mg of highly pure protein suitable for structural studies .

What analytical methods are most effective for studying the impact of plsY mutations on Cupriavidus taiwanensis membrane composition?

For studying the impact of plsY mutations on Cupriavidus taiwanensis membrane composition, an integrated analytical approach is most effective:

  • Lipidomic analysis platforms:

    • LC-MS/MS profiling: Utilize a reverse-phase HPLC coupled with tandem mass spectrometry for comprehensive phospholipid identification and quantification.

    • Shotgun lipidomics: Direct infusion MS/MS for rapid lipid class screening.

    • MALDI-TOF MS: For targeted analysis of specific phospholipid classes.

  • Quantitative phospholipid characterization:

    Phospholipid ClassWild-type (mol%)plsY Mutant (mol%)Analysis Method
    PhosphatidylethanolamineTBDTBDLC-MS/MS
    PhosphatidylglycerolTBDTBDLC-MS/MS
    CardiolipinTBDTBDLC-MS/MS
    LysophospholipidsTBDTBDLC-MS/MS
    Fatty acid compositionTBDTBDGC-MS
  • Membrane biophysical property assessment:

    • Fluorescence anisotropy: Measure membrane fluidity using DPH or other fluorescent probes.

    • Differential scanning calorimetry: Determine phase transition temperatures.

    • Atomic force microscopy: Examine nanoscale membrane organization and domain formation.

  • Functional membrane assays:

    • Membrane permeability: Utilize fluorescent dyes to assess barrier function.

    • Membrane potential measurements: Using voltage-sensitive dyes.

    • Protein mobility: FRAP (Fluorescence Recovery After Photobleaching) to analyze lateral diffusion of membrane proteins.

  • Stable isotope labeling approaches:

    • Incorporate ¹³C-labeled acetate or glycerol into culture media.

    • Track isotope incorporation into various lipid species using MS.

    • Calculate turnover rates and metabolic flux through different pathways.

  • Advanced imaging techniques:

    • STORM/PALM super-resolution microscopy: Visualize nanoscale membrane organization.

    • Cryo-electron microscopy: Examine membrane ultrastructure.

    • ToF-SIMS imaging: Map spatial distribution of specific lipids.

  • Data integration framework:

    • Multivariate statistical analysis to identify patterns in complex lipidomic datasets.

    • Systems biology approach integrating lipidomics with transcriptomics and proteomics.

This comprehensive analytical toolkit allows researchers to detect subtle changes in membrane composition resulting from plsY mutations and correlate these changes with functional outcomes .

How can research on Cupriavidus taiwanensis plsY contribute to understanding symbiotic relationships with host plants?

Research on Cupriavidus taiwanensis plsY can significantly contribute to understanding symbiotic relationships with host plants through several methodological approaches:

  • Membrane adaptation during symbiosis establishment:

    • Investigate plsY expression and activity changes during different stages of symbiosis.

    • Compare membrane lipid compositions between free-living C. taiwanensis and bacteroids within nodules.

    • Examine how altered membrane composition affects recognition by plant host receptors.

  • Metabolic integration with nitrogen fixation:

    • Study the relationship between phospholipid biosynthesis and nitrogenase activity.

    • Investigate how plsY activity responds to microaerobic conditions in nodules.

    • Examine carbon flux between phospholipid synthesis and energy provision for nitrogen fixation.

  • Host specificity mechanisms:

    • C. taiwanensis strains show differential nodulation capabilities with various Mimosa species. For instance, studies show that C. taiwanensis strains STM 6018 and LMG 19424T preferentially nodulate Mimosa pudica, while the Taiwanese accession M. pudica var. unijuga displays higher affinity for C. taiwanensis strains, suggesting local co-adaptation .

    • Investigate whether plsY-dependent membrane composition contributes to this host specificity.

    • Compare plsY sequences and activities across C. taiwanensis strains with different host ranges.

  • Signal transduction and environmental adaptation:

    • Examine how plant-derived signals modify plsY activity or expression.

    • Study potential crosstalk between plsY function and two-component regulatory systems.

    • Investigate whether plsY is involved in adaptation to the unique rhizosphere environment.

  • Experimental approaches for symbiosis studies:

    • Create plsY mutants with altered activity and assess their nodulation efficiency.

    • Perform competition studies between wild-type and plsY-modified strains.

    • Use fluorescently labeled lipids to track membrane remodeling during infection thread formation.

This research not only enhances understanding of C. taiwanensis symbiosis but may also provide insights applicable to other rhizobial relationships, potentially contributing to agricultural applications for improving biological nitrogen fixation .

What is the relationship between plsY function and polyhydroxybutyrate (PHB) accumulation in Cupriavidus species?

The relationship between plsY function and polyhydroxybutyrate (PHB) accumulation in Cupriavidus species involves complex metabolic interconnections that can be studied through several methodological approaches:

  • Metabolic competition for carbon and reducing equivalents:

    • Both phospholipid synthesis (regulated by plsY) and PHB production compete for acetyl-CoA and reducing power (NADPH).

    • Studies in related Cupriavidus species suggest that manipulating regulatory systems can redirect carbon flux between these pathways. For example, in Cupriavidus basilensis 4G11, elimination of genes for a two-component regulatory system increased PHB production during balanced growth .

    • This suggests that experimental manipulation of plsY activity might similarly affect carbon partitioning between membrane lipids and PHB storage.

  • Membrane requirements during PHB accumulation:

    • PHB accumulation occurs in cytoplasmic granules that interface with the bacterial membrane.

    • The composition and properties of these membrane-granule interfaces, potentially influenced by plsY activity, may affect PHB accumulation capacity.

    • Research approach: Compare membrane lipid composition around PHB granules under varying plsY expression levels.

  • Regulatory networks connecting lipid metabolism and PHB synthesis:

    • Two-component systems and other regulatory elements likely coordinate these pathways in response to nutrient availability.

    • In C. basilensis, deletion of specific regulatory genes (RR42_RS17055, RR42_RS17060) resulted in strains with higher values of the PIN parameter, indicating decreased reliance on nitrogen limitation to initiate PHB accumulation .

    • Similar regulatory elements might connect plsY activity to PHB production in C. taiwanensis.

  • Experimental design for investigating these connections:

    • Create plsY overexpression and knockdown strains in C. taiwanensis

    • Measure PHB accumulation under various carbon/nitrogen ratios

    • Perform metabolic flux analysis using isotope-labeled substrates

    • Analyze gene expression patterns across different growth phases

  • Data integration framework:

    • Develop a mathematical model integrating membrane lipid synthesis and PHB production

    • Use the model to predict optimal conditions for PHB production

    • Validate predictions experimentally through controlled fermentation studies

This research direction could lead to biotechnological applications, as understanding the relationship between plsY activity and PHB production might enable engineering of Cupriavidus strains with enhanced bioplastic production capabilities .

How might comparative analysis of plsY across different Cupriavidus species inform evolutionary adaptation strategies?

Comparative analysis of plsY across different Cupriavidus species offers valuable insights into evolutionary adaptation strategies through several methodological approaches:

  • Phylogenetic analysis and molecular evolution:

    • Construct phylogenetic trees based on plsY sequences from diverse Cupriavidus species and strains.

    • Calculate selection pressures (dN/dS ratios) to identify conserved functional regions versus adaptively evolving sites.

    • Correlate sequence variations with ecological niches and host specificities.

    The search results indicate that C. taiwanensis strains (STM 6018, LMG 19424T) are most closely related to C. nantongensis X1T, C. alkaliphilus ASC-732T, and "C. neocaledonicus" STM 6070, with 16S rRNA gene sequence identities ranging from 99.6% to 98.5% . Similar comparative analysis of plsY genes could reveal adaptation patterns.

  • Structure-function relationship analysis:

    • Use homology modeling to predict structural differences in plsY across species.

    • Identify potentially significant amino acid substitutions in substrate binding or catalytic sites.

    • Correlate structural variations with substrate preferences or enzyme kinetics.

  • Ecological correlation studies:

    • Map plsY sequence variations to ecological parameters:

      • Soil pH (Cupriavidus species dominate in neutral-alkaline soils)

      • Heavy metal content (many Cupriavidus species show metal resistance)

      • Host plant preferences (different affinities for Mimosa species)

    • Test hypotheses about adaptive significance through site-directed mutagenesis.

  • Horizontal gene transfer assessment:

    • Analyze plsY gene neighborhoods for evidence of mobile genetic elements.

    • Compare evolutionary histories of plsY genes with species phylogenies to detect horizontal transfers.

    • Examine whether plsY genes are included in symbiotic gene clusters that might transfer between species.

    The search results note that "symbiotic Cupriavidus populations have arisen via horizontal gene transfer" , suggesting that analysis of plsY evolution in this context could be informative.

  • Experimental validation approaches:

    • Express plsY genes from different Cupriavidus species in a common host.

    • Measure enzymatic properties under standardized conditions.

    • Perform complementation studies in plsY-deficient strains.

    • Test fitness under various environmental challenges.

  • Integrated data analysis framework:

    • Combine sequence data, structural predictions, and experimental results.

    • Use machine learning approaches to identify patterns linking sequence features to functional properties.

    • Develop predictive models for plsY function based on sequence alone.

This comparative approach not only illuminates the evolutionary history of plsY in Cupriavidus but also provides insights into bacterial adaptation strategies more broadly .

What are common challenges in obtaining active recombinant plsY from Cupriavidus taiwanensis and how can they be overcome?

Obtaining active recombinant plsY from Cupriavidus taiwanensis presents several challenges that can be addressed through specific methodological approaches:

  • Membrane protein expression difficulties:

    ChallengeSolution ApproachMethodological Details
    Protein misfoldingReduce expression temperatureExpress at 16-20°C rather than 37°C; use Arctic Express or similar cold-adapted expression strains
    AggregationOptimize detergent selectionScreen detergents systematically: start with mild detergents (DDM, LMNG) before trying harsher ones (LDAO, OG); consider fluorescence-based thermal stability assays to evaluate detergent effectiveness
    Toxicity to hostUse tightly controlled inductionEmploy arabinose-inducible or tetracycline-regulated systems; maintain glucose repression until induction
    Improper membrane insertionTry different fusion partnersTest MBP, GST, or SUMO fusions; position tags at either N- or C-terminus to determine optimal configuration
  • Protein solubilization and purification issues:

    • Challenge: Inefficient extraction from membranes

    • Solution: Optimize membrane preparation by testing different cell lysis methods (sonication, high-pressure homogenization, gentle lysis with lysozyme)

    • Method: Compare protein yields and activity after extraction with different detergent concentrations (0.5-2% for initial solubilization, 2-3× CMC for purification steps)

  • Enzymatic activity preservation:

    • Challenge: Loss of activity during purification

    • Solution: Include stabilizing agents in all buffers

    • Method: Add glycerol (10-20%), reduce detergent concentration to just above CMC, include phospholipids (0.1-0.5 mg/mL) from C. taiwanensis or similar bacteria to maintain a native-like environment

  • Protein yield optimization:

    • Challenge: Low expression levels

    • Solution: Codon optimization and expression vector engineering

    • Method: Optimize the 5' UTR to enhance translation initiation; remove rare codons; consider adding a C-terminal fusion partner that can be cleaved after purification

  • Activity assay troubleshooting:

    • Challenge: Low or inconsistent enzyme activity

    • Solution: Reconstitution into artificial membrane environments

    • Method: Test proteoliposome reconstitution, nanodiscs, or amphipol stabilization to provide a membrane-like environment for optimal activity

These approaches have been successfully applied to other membrane-bound acyltransferases and can be adapted specifically for C. taiwanensis plsY to obtain functionally active protein for biochemical and structural studies .

How can researchers effectively differentiate between the functions of plsY and other glycerol-3-phosphate acyltransferases when studying lipid metabolism in Cupriavidus taiwanensis?

Effectively differentiating between the functions of plsY and other glycerol-3-phosphate acyltransferases in Cupriavidus taiwanensis requires a multi-faceted methodological approach:

  • Genetic tools for specific targeting:

    • CRISPR/Cas9-based genome editing for precise knockouts or modifications of individual acyltransferase genes

    • Inducible expression systems to control plsY levels independently of other acyltransferases

    • RNAi or antisense RNA approaches for transient knockdowns when complete knockouts are lethal

  • Biochemical discrimination strategies:

    • Substrate specificity profiling: plsY typically uses acyl-phosphate donors while PlsB and other GPATs use acyl-CoA

    • Inhibitor sensitivity: Test differential sensitivity to specific inhibitors (e.g., FSG67 affects mammalian GPATs differently)

    • Cofactor requirements: Determine if different acyltransferases have distinct metal ion or other cofactor dependencies

  • Analytical approaches for pathway delineation:

    • Pulse-chase experiments with isotope-labeled precursors to track metabolic flux

    • Metabolomic analysis focusing on pathway intermediates

    • Time-course studies following gene induction or repression

  • Expression pattern analysis:

    • qRT-PCR to quantify expression levels of different acyltransferases under various conditions

    • Reporter gene fusions to visualize expression patterns in situ

    • ChIP-seq to identify differential regulation of acyltransferase genes

  • Structural and localization studies:

    • Generate fluorescent protein fusions to determine subcellular localization

    • Immunolocalization with specific antibodies

    • Membrane fractionation followed by activity assays and proteomics

  • Experimental design for functional separation:

    AcyltransferaseExpected Substrate PreferenceInhibitor SensitivityKey Experimental Approach
    plsYAcyl-phosphateTBDExpression in heterologous host lacking endogenous GPATs
    PlsB (if present)Long-chain acyl-CoATBDComplementation studies in conditional mutants
    Other GPATsVarious acyl-CoA length preferencesTBDIn vitro assays with purified enzymes
  • Bioinformatic approach:

    • Identify all potential GPAT-encoding genes in the C. taiwanensis genome through homology searches

    • Perform phylogenetic analysis to classify them into appropriate subfamilies

    • Predict substrate preferences based on conserved motifs and structural modeling

By integrating these approaches, researchers can create a comprehensive functional map of the various acyltransferases in C. taiwanensis and clarify the specific role of plsY in lipid metabolism .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.