Recombinant Cupriavidus taiwanensis NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice shipping is required, please contact us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
nuoK; RALTA_A1044; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CIP 107171 / LMG 19424 / R1) (Ralstonia taiwanensis (strain LMG 19424))
Target Names
nuoK
Target Protein Sequence
MLSLAHFLVLGAILFAISIVGIFLNRKNVIVLLMAIELMLLAVNINFVAFSHYLGDLAGQ VFVFFILTVAAAESAIGLAILVVLFRNLDTINVDDLDTLKG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. This process couples the redox reaction to proton translocation, where for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane, conserving the redox energy as a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of nuoK in Cupriavidus taiwanensis?

Basic Research Question

The nuoK gene (also annotated as RALTA_A1044) is located on chromosome 1 of Cupriavidus taiwanensis. C. taiwanensis LMG19424 possesses a genome consisting of two chromosomes (3.42 Mb and 2.50 Mb) and a large symbiotic plasmid (0.56 Mb) . The nuoK gene is part of the nuo operon encoding the components of the NADH:quinone oxidoreductase complex (NDH-1). This operon is highly conserved among bacteria that perform aerobic respiration. The genomic organization of C. taiwanensis is notable for its similarity to the saprophytic bacterium C. eutrophus H16, despite being 0.94 Mb smaller . This genomic context suggests that nuoK and its associated respiratory components have been maintained throughout the evolution of these related species, highlighting their fundamental importance to cellular metabolism.

What are the structural characteristics of nuoK protein in C. taiwanensis?

Basic Research Question

The nuoK protein in C. taiwanensis is a highly hydrophobic membrane subunit of the NDH-1 complex, bearing three transmembrane segments (TM1-3) . It is the counterpart of the mitochondrial ND4L subunit in eukaryotes, indicating evolutionary conservation of this respiratory component . The protein contains two critical glutamic acid residues: (K)Glu-36 located in the second transmembrane helix (TM2) and (K)Glu-72 in the third transmembrane helix (TM3) . These acidic residues are highly conserved and play crucial roles in the protein's function. Additionally, nuoK contains important arginine residues ((K)Arg-25 and (K)Arg-26) and an asparagine residue ((K)Asn-27) located in a short cytoplasmic loop between TM1 and TM2 that are critical for its energy transducing activities .

What expression systems are most effective for producing recombinant C. taiwanensis nuoK protein?

Advanced Research Question

Multiple expression systems have been utilized successfully for producing recombinant C. taiwanensis nuoK, each with distinct advantages depending on research objectives:

Expression SystemAdvantagesLimitationsTypical YieldPurity
E. coliRapid growth, simple genetics, high-yieldPotential improper folding of membrane proteinsModerate-high>85% (SDS-PAGE)
YeastBetter post-translational modificationsSlower growth than E. coliModerate>85% (SDS-PAGE)
BaculovirusSuperior for membrane proteins, mammalian-like modificationsComplex system, longer production timeVariable>85% (SDS-PAGE)
Mammalian cellsMost authentic post-translational modificationsExpensive, lower yieldsLower>85% (SDS-PAGE)

For basic biochemical analysis, E. coli-based systems are often sufficient and cost-effective. For functional studies requiring proper membrane insertion and post-translational modifications, eukaryotic systems such as yeast or insect cells (baculovirus) may be preferable. The choice of expression system should be guided by the specific research question, particularly whether native structural features need to be preserved for functional studies .

When expressing this membrane protein, optimization of detergent selection for solubilization is critical, with common choices including n-dodecyl-β-D-maltoside (DDM), n-octyl-β-D-glucopyranoside (OG), or digitonin. Depending on downstream applications, different affinity tags (His-tag, Avi-tag, etc.) can be incorporated, though care must be taken that these do not interfere with protein function or structure.

What are the key considerations for designing site-directed mutagenesis experiments involving nuoK?

Advanced Research Question

When designing site-directed mutagenesis experiments for nuoK, several critical factors must be considered:

  • Target Selection: The two glutamic acid residues (K)Glu-36 and (K)Glu-72 are primary targets due to their established functional importance. Previous research has shown that mutation of (K)Glu-36 to alanine leads to complete loss of NDH-1 activities, while mutation of (K)Glu-72 has a more moderate effect .

  • Positional Effects: Research has demonstrated that shifting (K)Glu-36 along TM2 to positions 32, 38, 39, and 40 still allows the mutants to retain significant energy-transducing NDH-1 activities . This suggests that the precise position of this residue within the same helical phase is somewhat flexible, as long as it remains within the vicinity of its native location (within one helical turn).

  • Charge Preservation vs. Removal: Consider whether to preserve the negative charge (E→D substitutions) or completely remove it (E→A or E→Q substitutions). Different substitutions can provide insights into whether the electrostatic properties or specific side-chain interactions are more important.

  • Loop Residues: The arginine residues (K)Arg-25 and (K)Arg-26 in the cytoplasmic loop-1 are also critical targets, as double mutation of these residues severely impacts energy-transducing activities .

  • Validation Methods: Activity assessments should include measurements of NADH:quinone oxidoreductase activity, proton pumping efficiency, and complex assembly to comprehensively understand the impact of mutations.

A systematic approach might involve creating a library of single and double mutants across the key residues, followed by functional characterization to create a comprehensive map of structure-function relationships.

How can researchers effectively solubilize and purify recombinant nuoK while maintaining its native conformation?

Advanced Research Question

Solubilization and purification of membrane proteins like nuoK require specialized approaches:

  • Membrane Isolation: Begin with differential centrifugation to isolate membrane fractions from expression host cells. Typically, cells are disrupted by sonication or French press, followed by low-speed centrifugation to remove cell debris and high-speed ultracentrifugation (100,000-150,000 × g) to pellet membranes.

  • Detergent Selection: Critical for maintaining native conformation. For nuoK:

    • Mild detergents (DDM, LMNG, or GDN) generally maintain better structural integrity

    • Conduct detergent screening with a thermal stability assay to identify optimal conditions

    • Consider lipid supplementation during solubilization (e.g., E. coli polar lipids at 0.1-0.5 mg/ml)

  • Purification Strategy:

    StepMethodBuffer ConditionsNotes
    AffinityIMAC (for His-tagged protein)20 mM Tris-HCl pH 8.0, 300 mM NaCl, 0.05% detergentTypical yield: 1-5 mg/L culture
    Size ExclusionSuperdex 20020 mM HEPES pH 7.5, 150 mM NaCl, 0.03% detergentSeparates monomeric vs. oligomeric states
    Ion ExchangeOptional cleanup20 mM MES pH 6.5, gradient to 1M NaClRemoves contaminants with similar size
  • Stability Assessment: Monitor protein stability using techniques such as thermal shift assays and limited proteolysis to confirm native folding.

  • Reconstitution Options: For functional studies, consider reconstitution into proteoliposomes or nanodiscs to provide a more native-like membrane environment. Typical lipid mixtures include POPC/POPE/POPG at ratios mimicking bacterial membranes.

The final product should achieve >85% purity as assessed by SDS-PAGE , with verification of proper folding through circular dichroism or tryptophan fluorescence spectroscopy before proceeding to functional assays.

What methods are most suitable for analyzing the proton-pumping activity of recombinant nuoK?

Advanced Research Question

Analyzing the proton-pumping activity of recombinant nuoK requires specialized techniques that can detect changes in proton gradients across membranes:

  • Reconstituted Proteoliposome Assays:

    • Preparation: Purified nuoK (or preferably the entire NDH-1 complex) should be reconstituted into liposomes with controlled lipid composition.

    • pH Monitoring: Using pH-sensitive fluorescent dyes such as ACMA (9-amino-6-chloro-2-methoxyacridine) or pyranine to detect changes in internal pH.

    • Procedure: Upon addition of NADH, active proton pumping results in quenching of ACMA fluorescence, which can be reversed by protonophores like CCCP.

  • Electrophysiological Approaches:

    • Planar Lipid Bilayer Electrophysiology: Allows direct measurement of proton currents across membranes containing reconstituted protein.

    • Patch-Clamp: Can be used with giant unilamellar vesicles (GUVs) containing the reconstituted protein.

  • Membrane Potential Measurements:

    • Voltage-sensitive dyes like DiSC3(5) or Oxonol VI can be used to monitor the membrane potential generated by proton pumping.

    • Technique: Observe changes in fluorescence upon energization with NADH, with controls using specific inhibitors.

  • Stopped-Flow Spectroscopy:

    • Rapid mixing of proteoliposomes with substrate allows real-time monitoring of initial proton translocation rates.

    • Can be coupled with pH-sensitive or potential-sensitive fluorescent probes.

  • Control Experiments:

    • Use site-directed mutants (particularly (K)Glu-36→Ala and (K)Glu-72→Ala) as negative controls .

    • Include ionophores (valinomycin+K⁺ for ΔΨ dissipation or nigericin for ΔpH dissipation) to distinguish components of the proton motive force.

Comparative analysis between wild-type and mutant variants can quantify the specific contribution of key residues to the proton-pumping mechanism, providing insights into the functional role of nuoK within the larger NDH-1 complex.

How does the structural organization of nuoK compare between C. taiwanensis and other bacterial species?

Advanced Research Question

The structural organization of nuoK shows both conservation and divergence across bacterial species:

FeatureC. taiwanensisE. coliP. denitrificansT. thermophilus
Transmembrane helices3 (TM1-3) 333
Key glutamate in TM2Glu-36 ConservedConservedConserved
Key glutamate in TM3Glu-72 ConservedConservedConserved
Cytoplasmic loop motifArg-Arg-Asn (25-27) ConservedConservedMore divergent
Length (amino acids)Partial (in recombinant) 10010398

The high conservation of the transmembrane topology and key functional residues across diverse bacterial species underscores the fundamental importance of nuoK in respiratory chain function. The most divergent regions typically occur in the loop regions, while the core transmembrane helices containing the critical glutamate residues maintain high sequence identity.

Phylogenetic analysis places C. taiwanensis nuoK within the beta-proteobacterial clade, with closest structural similarities to other Cupriavidus species and members of the Burkholderiaceae family. The evolutionary conservation extends to the spatial arrangement of the charged residues, which form part of a proposed proton-conducting pathway through the membrane domain of the NDH-1 complex.

The structural similarity between bacterial nuoK and mitochondrial ND4L further emphasizes the evolutionary conservation of this subunit, suggesting that insights gained from bacterial systems may be applicable to understanding mitochondrial respiratory complex I function and related human diseases.

How can researchers investigate the interaction between nuoK and other subunits of the NDH-1 complex?

Advanced Research Question

Investigating protein-protein interactions between nuoK and other NDH-1 subunits requires specialized approaches due to the hydrophobic nature of the membrane domain:

  • Cross-linking Studies:

    • Chemical cross-linking with MS/MS analysis: Using membrane-permeable crosslinkers like DSS or BS3 followed by digestion and LC-MS/MS analysis.

    • Photo-crosslinking: Incorporation of photo-activatable amino acids (e.g., p-benzoyl-L-phenylalanine) at specific positions to capture transient interactions.

    • Protocol optimization: Cross-linking conditions must be carefully controlled to minimize non-specific interactions.

  • Co-immunoprecipitation with Antibody Fragments:

    • Development of subunit-specific antibodies or nanobodies that recognize epitopes in hydrophilic regions.

    • Membrane solubilization must be performed under conditions that maintain native interactions.

  • Genetic Suppressor Analysis:

    • Introduction of destabilizing mutations in nuoK followed by selection for compensatory mutations in interacting subunits.

    • Analysis of evolutionary covariance patterns between nuoK and other subunits to identify co-evolving residue pairs.

  • Reconstitution Studies:

    • Systematic omission and re-addition of individual subunits to determine essential interactions.

    • Assessment of complex stability and activity to correlate structural interactions with function.

  • Blue Native PAGE and Complexome Profiling:

    • Analysis of complex assembly states under various conditions.

    • Combination with MS to quantify subunit stoichiometry and identify assembly intermediates.

  • Cryo-EM Analysis:

    • Although challenging due to the small size of nuoK, modern high-resolution cryo-EM can resolve inter-subunit contacts.

    • Focused classification methods can enhance resolution in the membrane domain.

What computational approaches can predict the impact of mutations on nuoK function and structure?

Advanced Research Question

Computational approaches offer powerful tools for predicting the functional and structural consequences of nuoK mutations:

  • Homology Modeling and Threading:

    • Generate structural models of C. taiwanensis nuoK based on homologous proteins with known structures.

    • Critical assessment: Compare models generated from multiple templates (bacterial NDH-1 and mitochondrial Complex I structures) to identify conserved structural features.

  • Molecular Dynamics Simulations:

    • All-atom MD simulations in explicit membrane environments can predict structural changes upon mutation.

    • Coarse-grained simulations allow for longer timescales to observe large conformational changes.

    • Analysis parameters should include RMSD, RMSF, hydrogen bond networks, and water/ion permeation.

  • Continuum Electrostatics Calculations:

    • Calculate pKa shifts of key residues in different conformational states.

    • Analyze electrostatic potential maps to identify potential proton pathways.

    • Predict changes in protonation states upon mutation of charged residues.

  • Quantum Mechanics/Molecular Mechanics (QM/MM):

    • For detailed analysis of proton transfer energetics at key glutamate residues.

    • Calculate energy barriers for proton jumping between residues to identify rate-limiting steps.

  • Machine Learning Approaches:

    • Train ML models on existing mutagenesis data to predict the impact of novel mutations.

    • Feature engineering should incorporate evolutionary conservation, physicochemical properties, and structural context.

  • Network Analysis of Evolutionary Couplings:

    • Identify networks of co-evolving residues that may be functionally linked.

    • Statistical coupling analysis can reveal allosteric networks within the protein.

For C. taiwanensis nuoK specifically, computational predictions have successfully identified the importance of the (K)Glu-36 residue in maintaining proton transfer capability. Simulations suggest that when this residue is mutated to alanine, the proton wire is disrupted, consistent with experimental observations of complete activity loss . Similarly, models predict a less severe disruption when (K)Glu-72 is mutated, aligning with the moderate reduction in activity observed experimentally .

How can researchers analyze the phenotypic effects of nuoK mutations on C. taiwanensis physiology and symbiotic capabilities?

Advanced Research Question

Analyzing the broader physiological and symbiotic impacts of nuoK mutations requires a multi-faceted approach:

  • Genetic Manipulation Strategies:

    • Allelic replacement: Use suicide vectors carrying mutated nuoK versions to generate chromosomal mutants.

    • Complementation analysis: Express wild-type nuoK in trans to confirm phenotype specificity.

    • Conditional expression systems: Use inducible promoters to control timing of mutant expression.

  • Growth Analysis Under Different Conditions:

    • Measure growth curves under various carbon sources and oxygen tensions.

    • Respiratory capacity assessment using oxygen consumption rate measurements.

    • Membrane potential monitoring in whole cells using fluorescent probes.

  • Metabolic Profiling:

    • Intracellular ATP/ADP ratios as indicators of energy status.

    • NAD+/NADH levels to assess redox balance.

    • Metabolomic analysis to identify metabolic bottlenecks caused by compromised respiration.

  • Symbiosis Assessment:

    • Plant inoculation assays with Mimosa pudica to evaluate nodulation efficiency .

    • Quantification of nitrogen fixation capacity using acetylene reduction assays.

    • Competition assays with wild-type strains to determine symbiotic fitness.

    • Histological analysis of nodule development and bacteroid differentiation.

  • Stress Response Analysis:

    • Oxidative stress tolerance (H2O2, paraquat exposure).

    • pH tolerance range, particularly acid stress which is relevant in the rhizosphere.

    • Osmotic stress resistance, which affects soil adaptation.

  • Transcriptomic and Proteomic Responses:

    • RNA-Seq to identify compensatory gene expression changes in nuoK mutants.

    • Proteome analysis to detect altered protein levels in respiratory and metabolic pathways.

    • Phosphoproteomics to identify signaling changes triggered by energy status alterations.

What approaches can be used to distinguish direct versus indirect effects of nuoK mutations on NDH-1 complex function?

Advanced Research Question

Distinguishing direct from indirect effects of nuoK mutations requires a systematic analytical framework:

  • Kinetic Analysis:

    • Measure NADH:quinone oxidoreductase activity across a range of substrate concentrations.

    • Determine if mutations affect Km (substrate binding) or Vmax (catalytic rate).

    • Analysis of inhibitor sensitivity profiles can reveal changes in binding sites or electron transfer pathways.

  • Assembly Assessment:

    • Blue Native PAGE to evaluate complex integrity and subunit incorporation.

    • Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) to detect subtle changes in complex size/shape.

    • Quantitative proteomics to measure stoichiometry of all NDH-1 subunits.

  • Domain-Specific Activity Measurements:

    • NADH dehydrogenase module activity (diaphorase activity) using artificial electron acceptors.

    • Quinone reduction module activity using reduced ferredoxin as electron donor.

    • These partial reactions can identify which functional module is directly affected.

  • Time-Resolved Spectroscopy:

    • Analyze the kinetics of electron transfer through the iron-sulfur clusters.

    • Detect changes in intermediate reduction states to pinpoint rate-limiting steps.

  • Conformational Dynamics Analysis:

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify regions with altered solvent accessibility.

    • Spectroscopic techniques (e.g., FRET) with site-specific labels to monitor distance changes between domains.

  • Discriminative Statistical Analysis:

    • Principal component analysis of multiple functional parameters to identify patterns.

    • Hierarchical clustering of mutant phenotypes to group mutations with similar mechanisms.

For nuoK specifically, direct effects would primarily involve proton pumping efficiency and local structural changes in the membrane domain, while indirect effects might include altered electron transfer rates, complex stability, or assembly defects. Research has shown that mutation of the key glutamate residue (K)Glu-36 to alanine causes complete loss of NDH-1 activities , strongly suggesting a direct effect on proton translocation rather than an indirect assembly defect, as shifting this residue to nearby positions (32, 38, 39, 40) preserves significant activity .

How can researchers correlate structural features of nuoK with its evolutionary conservation patterns?

Advanced Research Question

Correlating structure with evolutionary conservation requires integrated bioinformatic and structural biology approaches:

  • Multiple Sequence Alignment Analysis:

    • Construct comprehensive alignments of nuoK/ND4L sequences across bacterial, archaeal, and eukaryotic domains.

    • Calculate position-specific conservation scores using methods like Jensen-Shannon divergence.

    • Identify conservation patterns specific to different taxonomic groups (e.g., beta-proteobacteria vs. alpha-proteobacteria).

  • Structure-Based Conservation Mapping:

    • Project conservation scores onto 3D structural models.

    • Analyze spatial clustering of conserved residues to identify functional hotspots.

    • Compare surface conservation versus core conservation.

  • Evolutionary Rate Analysis:

    • Calculate site-specific evolutionary rates (dN/dS ratios) to identify sites under selective pressure.

    • Compare evolutionary rates between transmembrane regions and loop regions.

    • Test for signatures of diversifying versus purifying selection.

  • Co-evolution Network Analysis:

    • Identify networks of co-evolving residues using methods like statistical coupling analysis or direct coupling analysis.

    • Map co-evolution networks onto structural models to identify functional modules.

    • Compare intra-subunit versus inter-subunit co-evolution patterns.

  • Ancestral Sequence Reconstruction:

    • Infer ancestral sequences at key evolutionary nodes.

    • Analyze the timing and patterns of acquisition of key functional residues.

A comprehensive analysis of C. taiwanensis nuoK would reveal that the two critical glutamate residues ((K)Glu-36 and (K)Glu-72) show extremely high conservation across diverse species , consistent with their essential role in proton translocation. The transmembrane regions generally show higher conservation than loop regions, though certain loops (particularly the cytoplasmic loop containing (K)Arg-25 and (K)Arg-26) show remarkable conservation , suggesting functional importance beyond simple structural roles.

The evolutionary patterns also reveal that C. taiwanensis has maintained the core functionality of this respiratory chain component despite its adaptation to the specialized symbiotic lifestyle, underscoring the fundamental importance of energy transduction even in symbiotic bacteria.

What are the most promising approaches for investigating the interplay between nuoK function and symbiotic nitrogen fixation in C. taiwanensis?

Advanced Research Question

The intersection of respiratory function and symbiotic nitrogen fixation represents a frontier research area:

  • Metabolic Engineering Approaches:

    • Create conditional nuoK mutants using inducible systems to modulate respiratory capacity during different symbiotic stages.

    • Develop reporter strains with fluorescent proteins linked to nuoK expression to monitor spatial and temporal regulation in nodules.

    • Design synthetic bypass pathways to compensate for nuoK defects and test if symbiotic deficiencies can be rescued.

  • Integrated Multi-Omics Analysis:

    • Combine transcriptomics, proteomics, and metabolomics to create comprehensive models of energy metabolism during symbiosis.

    • Compare bacteroid vs. free-living expression patterns to identify symbiosis-specific regulatory mechanisms.

    • Analyze the impacts of varying oxygen tensions on nuoK expression and function in symbiosomes.

  • Advanced Imaging Techniques:

    • Use high-resolution microscopy with membrane potential-sensitive dyes to visualize respiration in individual bacteroids.

    • Apply correlative light and electron microscopy to connect respiratory activity with ultrastructural features.

    • Develop live-cell imaging approaches to monitor energy status in real-time during symbiotic development.

  • Host-Microbe Interaction Studies:

    • Investigate how plant-derived signals modulate bacterial respiratory chain composition and activity.

    • Examine how respiratory efficiency affects the plant's selection of symbiotic partners.

    • Analyze the consequences of altered respiration on plant growth and nitrogen status.

  • Comparative Analysis Across Rhizobial Species:

    • Compare NDH-1 complex structure and function between beta-rhizobia (like C. taiwanensis) and alpha-rhizobia.

    • Analyze convergent adaptations in respiratory chains that have evolved in different lineages of nitrogen-fixing symbionts.

These approaches could address fundamental questions about how bacteria balance their energy requirements during the transition from free-living to symbiotic states. The compact genome (0.94 Mb smaller than the related saprophytic C. eutrophus) and minimal symbiotic machinery (including the most compact 35-kb symbiotic island) of C. taiwanensis make it an excellent model system for studying the essential components required for symbiotic nitrogen fixation, including the role of energy-generating systems like NDH-1.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.