Recombinant Cupriavidus taiwanensis Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Cupriavidus taiwanensis prolipoprotein diacylglyceryl transferase (Lgt) is a genetically engineered form of the enzyme responsible for the first step in bacterial lipoprotein biosynthesis. Lgt catalyzes the transfer of an sn-1,2-diacylglyceryl group from phosphatidylglycerol to the thiol group of a conserved cysteine residue in prolipoproteins, forming a thioether bond critical for membrane anchoring . While C. taiwanensis is best known as a β-rhizobial symbiont of legumes like Mimosa pudica, its Lgt homolog shares functional and structural conservation with well-characterized Lgt enzymes from Escherichia coli and other Gram-negative bacteria . This article synthesizes current knowledge on Lgt’s biochemical properties, structural insights, and functional significance, with extrapolations to C. taiwanensis based on comparative genomics and experimental data from related systems.

Enzymatic Function and Role in Lipoprotein Biosynthesis

Lgt is essential for bacterial viability, as its depletion in E. coli and Listeria monocytogenes leads to cell envelope defects, increased membrane permeability, and lethality . In C. taiwanensis, lipoprotein biosynthesis is critical for maintaining outer membrane integrity and facilitating symbiotic interactions with host plants . The enzymatic process involves:

  1. Substrate recognition: Lgt targets prolipoproteins with a conserved lipobox motif ([LVI][ASTVI][GAS]C) .

  2. Diacylglyceryl transfer: The sn-1,2-diacylglyceryl moiety is transferred from phosphatidylglycerol to the cysteine thiol .

  3. Membrane localization: Modified lipoproteins are retained in the inner membrane or transported to the outer membrane via the Lol system .

Table 1: Key Functional Features of Lgt Across Bacterial Species

FeatureE. coli Lgt C. taiwanensis (Inferred)
EssentialityLethal upon depletionLikely essential
Membrane topology7 transmembrane segmentsPredicted similar topology
Critical residuesY26, N146, G154, R143Conserved in homologs
Subcellular localizationInner membraneInner membrane

Comparative Genomics and Evolutionary Context

C. taiwanensis Lgt is encoded within a genome enriched for horizontal gene transfer (HGT) events, particularly in loci involved in lipid metabolism and symbiosis . Key genomic insights include:

  • Conservation: The lgt gene is part of a core set of vertically inherited genes in rhizobia, despite widespread HGT in accessory loci .

  • Symbiotic relevance: Lipoproteins in C. taiwanensis likely contribute to host interaction, analogous to Sinorhizobium and Bradyrhizobium systems .

Applications and Future Directions

  1. Antimicrobial targeting: Lgt’s essentiality and conserved mechanism make it a candidate for broad-spectrum inhibitors .

  2. Symbiosis engineering: Modulating Lgt activity could alter lipoprotein-dependent signaling in plant-microbe interactions .

  3. Structural biology: Recombinant C. taiwanensis Lgt could enable cryo-EM studies to resolve mechanistic details .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we currently have in stock. However, if you have specific requirements for the format, please include them in your order notes. We will prepare the product according to your request.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery information.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
lgt; RALTA_A2459; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-272
Protein Length
full length protein
Species
Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CIP 107171 / LMG 19424 / R1) (Ralstonia taiwanensis (strain LMG 19424))
Target Names
lgt
Target Protein Sequence
MLIHPQFDPVAIHLGPLAIRWYGLMYLAGFIMFLWFGRLRIRQPHVAARGWTTRDLDDML FFGVLGVILGGRLGYVLFYKPSYYLSHPMEIFKVWEGGMAFHGGFLGVVVAMWLFGRLRR RHWMEVTDFIAPMIPCGLAAGRIGNFINGELWGRATDLPWGMIFPQAGDNIPRHPSQLYQ FAGEGVALFVILWLFARKPRPMGAVSGVFLIGYGAFRFAAEFAREPDNFLGLLALKLSMG QWLSLPMILAGIAMVIWAYRRQPGAGAPQPAA
Uniprot No.

Target Background

Function
Prolipoprotein diacylglyceryl transferase (Lgt) from *Cupriavidus taiwanensis* catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Prolipoprotein Diacylglyceryl Transferase (Lgt) and what is its role in bacterial physiology?

Prolipoprotein Diacylglyceryl Transferase (Lgt) is a membrane-bound enzyme that catalyzes the first and critical step in bacterial lipoprotein biogenesis. Specifically, Lgt transfers the diacylglyceryl moiety from phosphatidylglycerol (PG) to the conserved cysteine residue in the lipobox of preprolipoproteins via formation of a thioether bond . This lipid modification is essential for anchoring lipoproteins to the bacterial membrane. In Gram-negative bacteria like Cupriavidus taiwanensis and Escherichia coli, Lgt-processed lipoproteins play crucial roles in various cellular processes including cell envelope integrity, nutrient uptake, signaling, and virulence . Genetic studies have demonstrated that Lgt depletion in uropathogenic E. coli leads to outer membrane permeabilization and increased sensitivity to serum killing and antibiotics, highlighting its importance for bacterial survival .

How does the structure of Lgt facilitate its catalytic function?

The X-ray crystal structure of Lgt reveals a complex membrane protein architecture optimized for catalyzing lipid transfer reactions. Lgt contains multiple transmembrane (TM) domains with two conserved periplasmic loops (one preceding TM1 and another between TM2 and TM3) that form a central cavity with two distinct binding sites for the phosphatidylglycerol substrate . The structural arrangement facilitates the movement of PG from the first binding site to the second catalytic site where the diacylglyceryl transfer reaction occurs. The active site contains crucial residues including His103, which functions as a catalytic base that abstracts a proton from the conserved cysteine residue of the preprolipoprotein, facilitating nucleophilic attack on the PG substrate . Additionally, arginine residues (particularly Arg143 and Arg239) play essential roles in substrate binding and orientation through electrostatic interactions with the phosphate group of PG .

What expression systems are most effective for producing recombinant Cupriavidus taiwanensis Lgt?

For efficient expression of recombinant Cupriavidus taiwanensis Lgt, researchers should consider membrane protein-optimized expression systems. While not explicitly detailed for C. taiwanensis Lgt in the search results, successful expression strategies for bacterial membrane proteins like Lgt typically employ E. coli strains specifically designed for membrane protein expression, such as C41(DE3), C43(DE3), or Lemo21(DE3). For purification and biochemical analysis, Lgt can be solubilized using mild detergents that maintain protein structure and function. Expression constructs should include suitable affinity tags (His-tag or Strep-tag) positioned to avoid interference with the transmembrane domains. Induction conditions require careful optimization, with lower temperatures (16-20°C) and reduced inducer concentrations often yielding higher amounts of properly folded protein. The expression and purification protocols should be validated by enzymatic activity assays that measure the release of glycerol phosphate from PG substrates, as demonstrated for E. coli Lgt .

What molecular mechanisms underlie the catalytic activity of Lgt?

The catalytic mechanism of Lgt involves a sophisticated series of molecular interactions that facilitate the transfer of the diacylglyceryl group from phosphatidylglycerol to the preprolipoprotein substrate. Computational and structural studies have revealed that His103 serves as a critical catalytic base in the reaction mechanism . During catalysis, His103 abstracts a proton from the conserved cysteine residue of the preprolipoprotein, generating a nucleophilic thiolate that attacks the C3-O ester bond of the phosphatidylglycerol substrate . The activation of the C3-O ester bond is facilitated by Arg143, which forms stable electrostatic interactions with the phosphate O3 of PG and ionic interactions with Glu206, properly orienting the substrate for nucleophilic attack .

The reaction proceeds through the following steps:

  • Binding of PG to the first binding site in the Lgt central cavity

  • Translocation of PG to the second binding site (active site)

  • Binding of the preprolipoprotein substrate with exposure of the lipobox containing the conserved cysteine

  • Deprotonation of the cysteine thiol by His103

  • Nucleophilic attack of the thiolate on the C3-O ester bond of PG

  • Formation of the thioether bond and release of glycerol-1-phosphate as a byproduct

  • Release of the modified lipoprotein through the side cleft of Lgt

The presence of the glycerol head group in the PG molecule is crucial for properly orienting the catalytically important residues Arg143 and Arg239, organizing the active site for efficient diacylglycerol transfer .

How can computational approaches be used to study Lgt structure-function relationships?

Computational approaches provide powerful tools for investigating the structure-function relationships of Lgt. Based on research methodologies detailed in the literature, the following computational strategies can be effectively applied:

Molecular Docking and Binding Site Analysis:
Researchers can utilize molecular docking software such as Flexpepdock to model the binding interactions between Lgt and its substrates . This approach is particularly useful for understanding how preprolipoprotein peptides containing the characteristic lipobox (e.g., GSTLLAGCSSN) interact with the Lgt active site . The docking results can be assessed based on the distance between the C3 atom of PG and the cysteine sulfur of the lipobox, as well as their relative orientation, to evaluate the likelihood of reaction occurrence .

Molecular Dynamics (MD) Simulations:
MD simulations offer insights into the dynamic behavior of Lgt-substrate complexes. These simulations should be performed in a lipid bilayer environment to accurately model the membrane protein dynamics. For example, simulations can be conducted using the GPU version of the PMEMD engine integrated with the Amber package at physiologically relevant temperatures (310 K) . Three key complex systems that should be investigated include:

  • Lgt in complex with PG and diacylglycerol (DAG) (Lgt-PG-DAG)

  • Lgt in complex with two PG molecules (Lgt-PG)

  • Lgt in complex with two PG molecules and a docked preprolipoprotein (Lgt-PG-lipobox)

Quantum Mechanics/Molecular Mechanics (QM/MM) Calculations:
For detailed investigation of the catalytic mechanism, hybrid QM/MM calculations can elucidate the energetics and transition states involved in the lipid modification reaction. This approach is particularly valuable for understanding the proton transfer from the preprolipoprotein cysteine to His103 and the subsequent nucleophilic attack on the PG substrate .

Computational MethodApplication to Lgt ResearchKey Software/Tools
Molecular DockingSubstrate binding prediction, active site mappingFlexpepdock, AutoDock
MD SimulationsProtein dynamics, substrate interactions, conformational changesAMBER, NAMD, GROMACS
QM/MM CalculationsReaction mechanism, transition states, energy profilesGaussian, ONIOM, CP2K
Homology ModelingPredicting structures of Lgt variants from different speciesMODELLER, SWISS-MODEL
Electrostatic Surface AnalysisIdentifying key interaction sitesAPBS, PyMOL

What experimental approaches can be used to measure Lgt enzymatic activity in vitro?

Several experimental approaches can be employed to measure Lgt enzymatic activity in vitro, with the detection of reaction byproducts being particularly effective:

Glycerol Phosphate Release Assay:
A robust method for measuring Lgt activity involves tracking the release of glycerol phosphate, which is a byproduct of the Lgt-catalyzed transfer of diacylglyceryl from phosphatidylglycerol to a peptide substrate . The peptide substrate can be derived from bacterial lipoproteins such as Pal (e.g., Pal-IAAC, where C is the conserved cysteine modified by Lgt) . It's important to note that when using phosphatidylglycerol substrates with a racemic glycerol moiety, both glycerol-1-phosphate (G1P) and glycerol-3-phosphate (G3P) may be released .

For G3P detection, a coupled luciferase reaction can be implemented following this reaction cascade:

  • G3P + O₂ → dihydroxyacetone phosphate + H₂O₂ (catalyzed by glycerol-3-phosphate oxidase)

  • H₂O₂ + luciferin → oxidized luciferin + light (catalyzed by luciferase)

The light output can be measured using a luminometer, providing a quantitative readout of Lgt activity .

Fluorescently Labeled Peptide Substrate Assays:
This approach utilizes a fluorescently labeled peptide containing the lipobox motif. Upon lipidation by Lgt, the physicochemical properties of the peptide change, allowing detection via:

  • HPLC separation of modified and unmodified peptides

  • Changes in fluorescence polarization due to increased molecular weight

  • Mobility shifts in gel electrophoresis

Mass Spectrometry-Based Assays:
LC-MS/MS analysis can directly detect and quantify the lipidated peptide products of the Lgt reaction, providing both qualitative confirmation of lipid transfer and quantitative measurement of reaction efficiency.

For inhibitor studies, the IC₅₀ values of potential Lgt inhibitors can be determined using these assays. For example, compounds G9066, G2823, and G2824 have been identified as potent Lgt inhibitors with IC₅₀ values of 0.24 μM, 0.93 μM, and 0.18 μM, respectively .

How does Lgt from Cupriavidus taiwanensis compare to Lgt from other bacterial species?

Cupriavidus taiwanensis Lgt exhibits both conserved features and species-specific variations when compared to Lgt enzymes from other bacterial species. While detailed structural comparisons specific to C. taiwanensis Lgt are not explicitly provided in the search results, broader comparative analysis of bacterial Lgt enzymes reveals important insights:

Phylogenetic Context:
Cupriavidus taiwanensis belongs to the beta-proteobacteria and is known for its distinctive genomic features. Comparative genomic studies place C. taiwanensis in phylogenetic analyses alongside other bacteria such as Burkholderia phymatum . C. taiwanensis has been identified as having a long terminal branch in phylogenetic trees, suggesting significant evolutionary divergence that may extend to its functional proteins including Lgt .

  • Substrate specificity - Different Lgt orthologs may show preferences for specific phospholipid compositions or preprolipoprotein signal sequences

  • Membrane integration - The transmembrane topology may vary slightly while preserving the critical periplasmic loops

  • Inhibitor sensitivity - Response to inhibitors may differ based on variations in the binding pocket

Lateral Gene Transfer (LGT) Considerations:
Extensive lateral gene transfer has been observed in rhizobia including C. taiwanensis, with approximately 90% of core genes having undergone LGT or intergenic recombination in their evolutionary history . This high rate of genetic exchange suggests that Lgt itself may have been subject to LGT events, potentially incorporating functional elements from diverse bacterial lineages. Intragenic recombination has also been detected in many housekeeping genes, which could further contribute to functional divergence of Lgt between species .

Functional Implications in Different Bacterial Contexts:
The function of Lgt must be considered within the specific physiological context of C. taiwanensis as a rhizobial bacterium capable of nodulating leguminous plants. This environmental adaptation may have influenced the evolution of its Lgt to optimize for specific membrane compositions or lipoprotein requirements associated with plant-microbe interactions.

What are the recommended protocols for expression and purification of recombinant C. taiwanensis Lgt?

For successful expression and purification of recombinant Cupriavidus taiwanensis Lgt, researchers should implement a comprehensive protocol that addresses the challenges associated with membrane protein expression. Based on established methods for bacterial Lgt proteins, the following detailed protocol is recommended:

Expression Vector Design:

  • Select a vector with an inducible promoter (such as T7 or araBAD) for controlled expression

  • Include a C-terminal or N-terminal affinity tag (8x-His or Strep-tag II) positioned to avoid interference with transmembrane domains

  • Consider incorporating a cleavable signal sequence to ensure proper membrane insertion

  • Include a TEV protease cleavage site for tag removal if needed for structural studies

Expression Conditions:

  • Transform the expression construct into E. coli strains optimized for membrane protein expression (C41(DE3), C43(DE3), or Lemo21(DE3))

  • Culture cells in rich media (e.g., Terrific Broth) supplemented with appropriate antibiotics

  • Grow cultures at 37°C until OD600 reaches 0.6-0.8

  • Reduce temperature to 16-20°C before induction

  • Induce with a low concentration of inducer (0.1-0.4 mM IPTG or 0.002-0.02% arabinose)

  • Continue expression for 16-20 hours at the reduced temperature

Membrane Fraction Preparation:

  • Harvest cells by centrifugation (5,000 × g, 15 min, 4°C)

  • Resuspend in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, and protease inhibitors

  • Disrupt cells using sonication or high-pressure homogenization

  • Remove unbroken cells and debris by centrifugation (10,000 × g, 20 min, 4°C)

  • Ultracentrifuge the supernatant (100,000 × g, 1 hour, 4°C) to isolate membrane fraction

  • Resuspend membrane pellet in solubilization buffer

Protein Solubilization and Purification:

  • Solubilize membrane proteins using a mild detergent (n-dodecyl-β-D-maltoside (DDM) at 1-2%)

  • Stir gently for 1-2 hours at 4°C

  • Remove insoluble material by ultracentrifugation (100,000 × g, 30 min, 4°C)

  • Apply the supernatant to Ni-NTA or Strep-Tactin affinity resin

  • Wash with buffer containing 20-40 mM imidazole (for His-tag) or desthiobiotin (for Strep-tag)

  • Elute with buffer containing 250-300 mM imidazole or 2.5 mM desthiobiotin

  • Further purify by size exclusion chromatography using a Superdex 200 column

Quality Control and Activity Assessment:

  • Verify protein purity by SDS-PAGE

  • Confirm identity by Western blot and/or mass spectrometry

  • Assess enzymatic activity using the glycerol phosphate release assay described in section 2.3

  • Evaluate protein stability and monodispersity by dynamic light scattering

How can researchers design effective inhibitors targeting C. taiwanensis Lgt?

Designing effective inhibitors targeting Cupriavidus taiwanensis Lgt requires a multifaceted approach spanning computational prediction, synthetic chemistry, and rigorous biochemical validation. The following comprehensive strategy leverages structural insights and mechanistic understanding to develop potent and selective Lgt inhibitors:

Structure-Based Design Approach:

  • Utilize the known crystal structure of Lgt as a template for computational modeling of the C. taiwanensis ortholog

  • Identify the key catalytic residues, particularly His103 which functions as a catalytic base, and Arg143 which stabilizes the phosphate group of PG

  • Target the second PG binding site (active site) where the diacylglyceryl transfer reaction occurs

  • Design compounds that mimic the transition state of the reaction or competitively block substrate binding

Pharmacophore Development:
Based on the mechanism of Lgt, effective inhibitors should incorporate features that:

  • Mimic the diacylglyceryl moiety of PG to compete for binding

  • Include moieties that interact with His103 to prevent its function as a catalytic base

  • Incorporate groups that form electrostatic interactions with Arg143 and Arg239

  • Maintain appropriate lipophilicity for membrane penetration while preserving aqueous solubility

Examples of Effective Chemical Scaffolds:
Recent research has identified novel Lgt inhibitors with IC₅₀ values in the submicromolar range (G9066: 0.24 μM, G2823: 0.93 μM, and G2824: 0.18 μM) . These compounds can serve as valuable starting points for developing inhibitors specific to C. taiwanensis Lgt.

Compound IDIC₅₀ (μM)Activity Against Bacterial StrainsChemical Class
G90660.24Bactericidal against A. baumannii and E. coliNot specified in search results
G28230.93Bactericidal against A. baumannii and E. coliNot specified in search results
G28240.18Bactericidal against A. baumannii and E. coliNot specified in search results

Validation and Optimization Pipeline:

  • Virtual Screening: Use molecular docking to screen compound libraries against the modeled C. taiwanensis Lgt active site

  • Biochemical Validation: Test promising compounds using the glycerol phosphate release assay to determine IC₅₀ values

  • Structure-Activity Relationship (SAR) Studies: Systematically modify lead compounds to improve potency and selectivity

  • Resistance Profiling: Assess potential for resistance development - an important consideration as deletion of the major outer membrane lipoprotein (lpp) is not sufficient to rescue growth after Lgt depletion or provide resistance to Lgt inhibitors, suggesting a reduced likelihood of this common resistance mechanism

  • Cellular Activity: Test inhibitors for bactericidal activity against wild-type C. taiwanensis and related bacteria

  • Specificity Testing: Evaluate activity against mammalian enzymes to ensure selective targeting of bacterial Lgt

How can researchers reconcile contradictory results in Lgt structure-function studies?

When confronting contradictory results in Lgt structure-function studies, researchers should implement a systematic approach to data analysis and validation. Contradictions may arise from various sources including methodological differences, strain variations, or differential experimental conditions. The following framework provides a methodical strategy for resolving such contradictions:

Identify Sources of Variation:

  • Experimental Systems: Different expression systems, host organisms, or purification methods can significantly impact Lgt structure and activity

  • Species-Specific Differences: Contradictions may stem from comparing Lgt from different bacterial species, as substantial variation exists between orthologs

  • Substrate Composition: Variations in phospholipid composition or peptide substrates can lead to contradictory kinetic parameters

  • Assay Methodologies: Different detection methods may yield inconsistent results due to varying sensitivities or interferences

Resolution Strategies:

1. Cross-Validation of Structural Data:
When crystallographic data appears to contradict functional studies, researchers should employ complementary structural techniques. For instance, in the case of Lgt, the crystal structure showed the second PG binding site occupied by a DAG molecule (the hydrolyzed product) rather than the intact PG substrate, and the lipobox of the preprolipoprotein was missing . This seemingly catalytically unproductive structure was reconciled through molecular docking and MD simulations that provided insights into the complete reaction mechanism .

2. Statistical Approaches for Data Integration:
Methods such as the Shimodaira-Hasegawa (SH) test can be employed to evaluate the congruence of different data sets, as demonstrated in comparative genomic studies involving Cupriavidus taiwanensis . This statistical framework helps determine whether observed differences are significant or within the expected range of variation.

3. Comprehensive Sequence-Structure-Function Analysis:
For contradictions related to species-specific Lgt variations, researchers should conduct:

  • Multiple sequence alignments to identify conserved vs. variable regions

  • Homology modeling based on validated crystal structures

  • Functional assays with site-directed mutagenesis to test hypotheses about critical residues

4. Standardized Reporting Framework:
To minimize contradictions in future studies, researchers should adopt standardized reporting practices for Lgt research, including:

  • Detailed description of expression constructs and protein boundaries

  • Complete characterization of lipid and peptide substrates

  • Standardized assay conditions with appropriate controls

  • Thorough reporting of kinetic parameters and their statistical significance

What is the relationship between lateral gene transfer and functional evolution of Lgt in Cupriavidus taiwanensis?

The relationship between lateral gene transfer (LGT) and the functional evolution of Lgt in Cupriavidus taiwanensis represents a fascinating aspect of bacterial enzyme evolution with significant implications for understanding functional adaptation and diversity. The available evidence suggests a complex interplay between genetic exchange and functional specialization:

Evidence for Extensive LGT in Cupriavidus taiwanensis:
Comparative genomic studies reveal that C. taiwanensis has undergone substantial lateral gene transfer throughout its evolutionary history . Analysis using statistical frameworks such as the Shimodaira-Hasegawa (SH) test identified that approximately 90% of core genes in rhizobia including C. taiwanensis have experienced LGT or intergenic recombination . This extensive genetic exchange forms the backdrop against which Lgt evolution must be understood.

Mechanisms of Genetic Exchange:
Two distinct mechanisms have contributed to genetic diversity in C. taiwanensis:

  • Intergenic Recombination: Complete gene replacement through homologous recombination

  • Intragenic Recombination: Mosaic genes formed through recombination within the coding sequence

Both mechanisms may have influenced Lgt evolution, potentially creating a mosaic enzyme with functional domains derived from different bacterial lineages.

Functional Implications of LGT for Lgt:
The high rate of LGT suggests that Lgt in C. taiwanensis may incorporate functional elements from diverse bacterial sources, potentially conferring:

  • Substrate Adaptability: Enhanced ability to recognize different preprolipoprotein signal sequences

  • Environmental Adaptation: Optimization for the specific membrane composition and environmental conditions encountered by C. taiwanensis

  • Functional Innovation: Novel catalytic properties that may provide selective advantages

Phylogenetic Context:
C. taiwanensis is characterized by having a long terminal branch in phylogenetic analyses, suggesting significant evolutionary divergence from related species . This divergence may reflect unique adaptations in its core cellular machinery, including Lgt, that could be partly attributed to LGT events.

Research Approaches to Study LGT Impact on Lgt:

  • Phylogenetic Analysis: Construct gene trees specifically for Lgt across diverse bacterial species to identify potential LGT events

  • Sequence Analysis: Employ methods such as the phi (Φw) statistic to detect intragenic recombination within the Lgt gene

  • Functional Characterization: Compare the substrate specificity and catalytic efficiency of C. taiwanensis Lgt with orthologs from potential donor species

  • Domain Analysis: Identify potentially recombinant segments by comparing domain architecture across different bacterial lineages

The evolutionary trajectory of Lgt in C. taiwanensis thus likely represents a balance between conservation of essential catalytic function and innovation through genetic exchange, contributing to the species' ecological adaptation and biochemical specialization.

What emerging technologies could advance our understanding of Lgt structure and function?

The study of Lgt structure and function stands to benefit significantly from several emerging technologies that offer unprecedented resolution and analytical capabilities. Researchers investigating Cupriavidus taiwanensis Lgt should consider integrating the following cutting-edge approaches into their experimental design:

Cryo-Electron Microscopy (Cryo-EM):
While X-ray crystallography has provided valuable insights into Lgt structure , cryo-EM offers distinct advantages for membrane proteins. This technique can:

  • Capture Lgt in different conformational states during catalysis

  • Visualize the enzyme in native-like lipid environments without crystallization artifacts

  • Potentially resolve the complete complex of Lgt with both PG and preprolipoprotein substrates, addressing limitations in current structural data where only the DAG product was observed in the active site

Single-Molecule FRET:
This technique can provide real-time insights into the dynamics of substrate binding and product release during Lgt catalysis. Specifically, researchers could:

  • Label PG substrates and preprolipoprotein with appropriate FRET pairs

  • Monitor the movement of PG from the first binding site to the second catalytic site

  • Track conformational changes in Lgt during different stages of catalysis

Time-Resolved X-ray Crystallography:
This method could potentially capture intermediate states in the Lgt catalytic cycle, providing direct evidence for the proposed reaction mechanism involving His103 as a catalytic base .

Advanced Computational Methods:
Beyond the molecular docking and MD simulations already applied to Lgt , emerging computational approaches include:

  • Machine Learning for Protein-Ligand Interactions: AI-driven prediction of inhibitor binding modes and affinities

  • Enhanced Sampling Methods: Techniques such as metadynamics or replica exchange to explore conformational landscapes more efficiently

  • Polarizable Force Fields: More accurate representation of electrostatic interactions critical for understanding Arg143 and Arg239 interactions with the PG substrate

Synthetic Biology Approaches:

  • Directed Evolution: Creation of Lgt variants with enhanced activity or altered specificity

  • Minimal Synthetic Membranes: Reconstitution of Lgt in defined lipid compositions to understand membrane environment effects

  • Orthogonal Translation Systems: Incorporation of non-canonical amino acids at key positions to probe mechanism

Contradiction Detection in Generated Data:
As highlighted in recent literature on Retrieval Augmented Generation (RAG) systems, automated methods for detecting contradictions in research data could be valuable for reconciling inconsistent results across different Lgt studies . Such approaches could help identify when contradictory results stem from methodological differences versus genuine biological variation.

How might Lgt inhibitors be optimized to overcome potential resistance mechanisms?

The development of Lgt inhibitors with reduced vulnerability to resistance mechanisms represents a critical research direction. Unlike inhibitors targeting other steps in lipoprotein biosynthesis, Lgt inhibitors may possess inherent advantages against common resistance strategies, as evidence suggests that deletion of the major outer membrane lipoprotein (lpp) is not sufficient to rescue growth after Lgt depletion or provide resistance to Lgt inhibitors . This unique characteristic provides a promising foundation for antibiotic development, which can be further optimized through the following strategies:

Multi-Target Inhibitor Design:
Develop dual-action compounds that simultaneously inhibit Lgt and a second essential target, reducing the probability of resistance development through single mutations. Potential secondary targets could include:

  • Other enzymes in the lipoprotein biosynthesis pathway (Lsp, Lnt)

  • Cell envelope integrity components

  • Essential membrane transporters

Structure-Based Resistance Prevention:
Utilize structural insights from Lgt to design inhibitors that:

  • Interact with highly conserved residues essential for catalysis (His103, Arg143, Arg239)

  • Occupy multiple binding subsites within the active site

  • Form contacts with residues that cannot mutate without severe fitness cost to the bacterium

Delivery System Optimization:
Develop specialized delivery systems that enhance Lgt inhibitor access to their target:

  • Membrane-penetrating peptide conjugates

  • Siderophore-drug conjugates for iron transport-mediated delivery

  • Nanoparticle formulations that fuse with bacterial membranes

Resistance Mechanism Mapping:
Conduct comprehensive studies to identify and characterize potential resistance mechanisms:

  • Perform directed evolution experiments under Lgt inhibitor selective pressure

  • Sequence resistant mutants to identify genetic alterations

  • Characterize the fitness cost of resistance-conferring mutations

  • Use this information to design inhibitors specifically targeting resistance-proof regions

Species-Specific Considerations for C. taiwanensis:
For Cupriavidus taiwanensis-specific Lgt inhibitors, consider:

  • The extensive lateral gene transfer history of this species , which may influence the evolution of resistance

  • The specialized environmental niche of C. taiwanensis as a rhizobial bacterium

  • Potential unique structural features resulting from its evolutionary divergence indicated by its long terminal branch in phylogenetic analyses

By implementing these strategies, researchers can develop Lgt inhibitors with reduced susceptibility to resistance development, potentially overcoming one of the major challenges in antibiotic development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.