Recombinant Cuscuta exaltata Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Cuscuta exaltata Apocytochrome f (petA)

Recombinant Cuscuta exaltata Apocytochrome f (petA) is a protein expressed using recombinant DNA technology, derived from the parasitic plant species Cuscuta exaltata, also known as tall dodder . Apocytochrome f (petA) is a subunit of the cytochrome b6f complex, a crucial component of the photosynthetic electron transport chain found in the chloroplasts of plants .

Protein Information

  • Product Type: Recombinant Protein

  • Species: Cuscuta exaltata (Tall dodder)

  • Uniprot NO.: A8W3D1

  • Tag Info: The tag type is determined during the production process .

  • Storage Buffer: Tris-based buffer, 50% glycerol, optimized for this protein

  • Storage: Store at -20℃; for extended storage, conserve at -20℃ or -80℃. Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week .

  • AA Sequence: YPIFAQRGYENPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVVRIPYDSQLKQVLSNGKKGGLNVGAVIILPEGFELAPPDRLSPQMKEKIGNLSFQNYRPNQKNIIVVGPVPGQKYSEITFPILSPDPATKKDAHFLKYPIYVGGNRGRGQIYPDGSKSNNTFYSATAAGIVSKIIRKEKGGYEITITDASDSHQVVEIIPPGPELLVSEGEYLKFDQPLTSNPNVGGFGQGDGEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNL

  • Protein Names: Recommended name: Apocytochrome f

  • Gene Names: Name: petA

  • Expression Region: 36-320

  • Sequence Info: Full length protein

Function and Significance

  1. Photosynthetic Electron Transport: Cytochrome f, encoded by the petA gene, is a subunit of the cytochrome b6f complex, essential for electron transfer between Photosystem II and Photosystem I in the thylakoid membrane of chloroplasts .

  2. Recombinant Production: The recombinant form of Cuscuta exaltata Apocytochrome f (petA) is produced using genetic engineering techniques, allowing for large-scale production and purification of the protein for research purposes .

  3. Study of Parasitic Plants: Cuscuta species are parasitic plants that obtain nutrients from host plants. Studying their proteins, like Apocytochrome f, can provide insights into their unique biology and mechanisms of parasitism .

Potential Applications

  1. ELISA Assays: Recombinant Cuscuta exaltata Apocytochrome f (petA) can be used as an antigen in Enzyme-Linked Immunosorbent Assays (ELISA) for detecting antibodies or other proteins that interact with it .

  2. Protein Interaction Studies: The recombinant protein can be utilized in various biochemical assays to study its interactions with other proteins, providing a better understanding of its role in photosynthesis and other cellular processes .

  3. Structural Studies: Recombinant production allows for the generation of sufficient quantities of the protein for structural analysis using techniques such as X-ray crystallography or NMR spectroscopy .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petA; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-320
Protein Length
Full Length of Mature Protein
Species
Cuscuta exaltata (Tall dodder)
Target Names
petA
Target Protein Sequence
YPIFAQRGYENPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVVRIPYDSQLKQV LSNGKKGGLNVGAVIILPEGFELAPPDRLSPQMKEKIGNLSFQNYRPNQKNIIVVGPVPG QKYSEITFPILSPDPATKKDAHFLKYPIYVGGNRGRGQIYPDGSKSNNTFYSATAAGIVS KIIRKEKGGYEITITDASDSHQVVEIIPPGPELLVSEGEYLKFDQPLTSNPNVGGFGQGD GEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNL
Uniprot No.

Target Background

Function
Recombinant Cuscuta exaltata Apocytochrome f (petA) is a component of the cytochrome b6-f complex. This complex facilitates electron transfer between Photosystem II (PSII) and Photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome f family
Subcellular Location
Plastid thylakoid membrane; Single-pass membrane protein.

Q&A

What is Apocytochrome f (petA) and why is its presence in Cuscuta exaltata significant?

Apocytochrome f, encoded by the petA gene, is a critical component of the cytochrome b6f complex in the photosynthetic electron transport chain located in the thylakoid membrane of chloroplasts. Its retention in Cuscuta exaltata is particularly significant because, despite being a parasitic plant, C. exaltata maintains photosynthetic capacity. Unlike other parasitic plants that have lost photosynthetic genes, C. exaltata retains photosynthetic and photorespiratory genes that evolve under strong selective constraint, even after losing all ndh genes . This retention provides valuable insights into the evolutionary transition to parasitism and the selection pressures on plastid genomes during this process.

How does Cuscuta exaltata differ from other Cuscuta species in terms of plastid genome content?

Cuscuta exaltata belongs to the subgenus Monogynella and exhibits notable differences in plastid genome composition compared to other Cuscuta species:

SpeciesPhotosynthetic genesndh genesRNA polymerase genesSelection pressure on photosynthetic genes
C. exaltataAll retainedAll lostRetainedStrong constraint
C. obtusifloraAlmost all retainedAll lostAll lostModerate constraint
C. reflexaMost retainedAll lostRetainedModerate constraint
C. campestrisSome lostAll lostSome lostRelaxed constraint

Unlike Epifagus virginiana (another parasitic plant with a sequenced plastid genome), which has lost all photosynthesis-related genes, C. exaltata maintains a functional photosynthetic apparatus . Analyses demonstrate that photosynthetic genes are under the highest constraint of any genes within the plastid genomes of Cuscuta, indicating that a function involving RuBisCo and electron transport through photosystems remains the primary reason for retention of the plastid genome in these species .

What are the morphological and ecological characteristics of Cuscuta exaltata as they relate to its molecular biology?

Cuscuta exaltata (Tall Dodder or Tree Dodder) is distinguished by the following characteristics:

  • Morphology: Annual vine with thin stems appearing leafless, with leaves reduced to minute scales

  • Host preference: Parasitizes woody hosts including Quercus, Ulmus, Diospyros, Vitis, and Rhus species

  • Distribution: Native to northern peninsular Florida and Texas

  • Phenology: Flowers from May to October with white to green blooms

  • Habitat: Dry hammocks (FL), dry woodlands (TX)

Unlike some other parasitic plants, C. exaltata maintains photosynthetic capacity, which is reflected in its molecular biology through the retention of key photosynthetic genes like petA . This partial photosynthetic capability likely influences its host range and ecological niche, allowing it to supplement host-derived nutrition with its own photosynthesis.

What protocols are recommended for isolating and expressing recombinant petA gene from Cuscuta exaltata?

While specific protocols for C. exaltata are not fully standardized, researchers can adapt approaches from related species:

Recommended isolation protocol:

  • Sample collection and preparation:

    • Collect fresh C. exaltata material from appropriate woody hosts

    • Flash-freeze in liquid nitrogen and store at -80°C until use

    • Grind tissue in liquid nitrogen to a fine powder

  • DNA extraction for gene isolation:

    • Use CTAB-based extraction methods optimized for parasitic plants

    • Include PVP and higher concentrations of β-mercaptoethanol to remove phenolic compounds

    • Perform RNase treatment followed by phenol:chloroform purification

  • Gene amplification and cloning:

    • Design primers based on conserved regions of petA in related Cuscuta species

    • Use high-fidelity polymerase for PCR amplification

    • Clone the amplified fragment into an appropriate expression vector

  • Expression system:

    • Bacterial expression (E. coli BL21(DE3) or similar strains) using pET vectors

    • Alternatively, use plant-based expression systems for proper folding

The expression of membrane proteins like Apocytochrome f presents specific challenges requiring optimization of induction conditions, temperature, and potentially the use of fusion tags to enhance solubility .

How can researchers effectively transform Cuscuta species for functional studies of petA?

Recent advances in transformation technologies for Cuscuta species provide promising approaches:

Transformation protocol for Cuscuta species:

  • Preparation of plant material:

    • Expose C. exaltata stems to far-red light treatment (similar to protocol developed for C. reflexa )

    • Allow formation of adhesive disks/haustoria structures

  • Agrobacterium-mediated transformation:

    • Both A. rhizogenes and A. tumefaciens carrying binary transformation vectors have shown success with Cuscuta species

    • Adjust Agrobacterium culture to OD600 of 1-1.6

    • Soak paper in bacterial suspension and apply to treated Cuscuta stems

  • Incubation conditions:

    • Incubate in dark conditions at room temperature for approximately 7 days

    • Rinse stems under tap water to remove excess bacteria

  • Analysis of transformation:

    • Use fluorescent reporter genes to confirm transformation

    • The cell layer below the adhesive disk's epidermis shows highest transformation efficiency

    • For C. reflexa, transformed cells were observed most frequently in the infection structures

This approach has shown high efficiency in C. reflexa and may be adaptable to C. exaltata, though species-specific optimizations may be necessary .

What are the recommended methods for purifying and characterizing recombinant Apocytochrome f protein?

Purification protocol:

  • Cell lysis and membrane fraction isolation:

    • Use mechanical disruption combined with enzymatic treatment for expression systems

    • Isolate membrane fractions through differential centrifugation

    • Solubilize membrane proteins using appropriate detergents (e.g., n-dodecyl-β-D-maltoside)

  • Chromatography methods:

    • Initial purification: Immobilized metal affinity chromatography (if His-tagged)

    • Secondary purification: Ion exchange chromatography

    • Final polishing: Size exclusion chromatography

  • Protein characterization:

    • SDS-PAGE analysis with heme staining

    • Western blotting with anti-cytochrome f antibodies

    • UV-Vis spectroscopy to analyze heme incorporation (absorption peaks at ~553 nm reduced and ~521 nm oxidized)

    • Circular dichroism spectroscopy for secondary structure analysis

    • Mass spectrometry for accurate molecular weight determination and post-translational modifications

  • Functional characterization:

    • Electron transfer activity assays using artificial electron donors/acceptors

    • Reconstitution experiments in liposomes to assess membrane integration

    • Spectroelectrochemical analysis to determine redox potentials

Protein yield and activity should be carefully monitored throughout the purification process, as membrane proteins like Apocytochrome f can lose activity during detergent extraction and purification steps.

How can comparative analyses of petA sequences from different Cuscuta species inform our understanding of parasitic plant evolution?

Comparative analyses of petA sequences across Cuscuta species offer valuable insights into parasitic plant evolution:

Key research approaches:

  • Sequence comparison methodology:

    • Align petA sequences from C. exaltata, C. obtusiflora, C. reflexa, and other species

    • Calculate synonymous (dS) and non-synonymous (dN) substitution rates

    • Use codon-based models of molecular evolution to detect selection patterns

    • Perform phylogenetic analyses using maximum likelihood or Bayesian approaches

  • Evolutionary patterns observed:

    • Photosynthetic genes like petA show strong selective constraint in C. exaltata compared to other Cuscuta species

    • Analysis of dN/dS ratios across different domains of Apocytochrome f can identify functionally critical regions

    • Comparative rate tests between parasitic and non-parasitic relatives reveal evolutionary trajectories

The selective retention of photosynthetic genes in C. exaltata stands in contrast to the gene loss patterns in other parasitic plants. This suggests that despite its parasitic lifestyle, C. exaltata maintains some level of photosynthetic activity that provides sufficient selective advantage to preserve these genes . The intermediate evolutionary state of C. exaltata represents a valuable model for understanding the transition to parasitism.

What are the challenges in studying protein-protein interactions involving Apocytochrome f in Cuscuta exaltata, and how can they be overcome?

Studying protein-protein interactions (PPIs) involving membrane proteins like Apocytochrome f presents several challenges:

Challenges and solutions:

ChallengeTechnical SolutionMethodological Approach
Membrane protein solubilizationOptimize detergent selectionScreen multiple detergents; use nanodiscs or amphipols
Maintaining native conformationGentle extraction conditionsUse mild detergents; employ lipid bilayer systems
Low expression levelsOptimize expression systemsTest different promoters, hosts, and fusion partners
Complex formation stabilityCrosslinking techniquesUse chemical crosslinkers or photo-crosslinking amino acids
Verification of interactionsMultiple complementary methodsCombine co-immunoprecipitation, FRET, BiFC, and SPR

Recommended advanced approaches:

  • In planta interaction studies:

    • Utilize the transformation protocol for Cuscuta developed for C. reflexa

    • Employ bimolecular fluorescence complementation (BiFC) to visualize interactions

    • Use FRET-based approaches for real-time interaction dynamics

  • Structural biology approaches:

    • Cryo-electron microscopy of membrane protein complexes

    • Hydrogen-deuterium exchange mass spectrometry for interaction interfaces

    • Integrative structural modeling combining multiple data types

  • Proteome-wide interaction mapping:

    • Proximity labeling approaches (BioID or APEX2)

    • Quantitative affinity purification-mass spectrometry

    • Comparison with interactomes from non-parasitic relatives

These approaches provide complementary data to build a comprehensive understanding of how Apocytochrome f interactions may have evolved in C. exaltata compared to non-parasitic relatives.

How does the structure and function of Apocytochrome f in Cuscuta exaltata compare with those of photosynthetically independent parasitic plants and photosynthetically active non-parasitic plants?

Comparative analysis reveals key insights into evolutionary adaptation:

Comparative structural and functional analysis:

Plant TypeExamplespetA RetentionStructural FeaturesFunctional Characteristics
Photosynthetically active parasiticC. exaltataCompleteConserved heme-binding motifFunctional electron transport
Partially photosynthetic parasiticC. obtusifloraComplete but divergentSome modifications in solvent-exposed regionsLikely functional but potentially altered kinetics
Non-photosynthetic parasiticEpifagus virginianaLostN/A (gene absent)Non-functional
Non-parasitic relativeIpomoea purpureaCompleteHighly conserved structureFully functional

Research implications:

  • Structure-function relationship:

    • The retention of conserved regions in C. exaltata's Apocytochrome f suggests maintained functionality

    • Any amino acid substitutions unique to C. exaltata may indicate adaptation to its partially parasitic lifestyle

    • Molecular dynamics simulations could identify how specific substitutions affect protein dynamics

  • Evolutionary trajectory hypothesis:

    • The evolution from autotrophy to partial heterotrophy in Cuscuta likely involved selective retention of essential photosynthetic components

    • The presence of functional petA in C. exaltata suggests it represents an intermediate evolutionary state

    • This provides a model for studying the gradual transition to obligate parasitism

This comparative approach illuminates the molecular underpinnings of parasitism evolution and helps identify which components of the photosynthetic apparatus are most critical for maintaining partial photosynthetic capacity .

How can research on Cuscuta exaltata petA contribute to our understanding of chloroplast genome evolution in parasitic plants?

Research on C. exaltata petA offers several key contributions to understanding chloroplast genome evolution:

Current understanding and research directions:

  • Selective retention patterns:

    • C. exaltata retains photosynthetic genes under strong selective constraint despite parasitism

    • This contrasts with the pattern seen in many other parasitic plants

    • Research can focus on identifying the selective forces maintaining these genes

  • Methodological approaches:

    • Comparative genomics across Cuscuta species with varying degrees of photosynthetic capacity

    • Analysis of selection patterns (dN/dS) across the plastid genome

    • Transcriptomic analysis to determine if retained genes are actively expressed

    • Proteomic studies to confirm protein production and functionality

  • Theoretical framework:

    • Research on C. exaltata supports a model where reduction of plastid genomes in parasitic plants occurs gradually

    • The pattern of gene loss appears non-random, with functionally related genes often lost together

    • The retention of photosynthetic genes in C. exaltata suggests that even limited photosynthetic ability provides sufficient selective advantage

This research has broader implications for understanding organellar genome evolution and the forces shaping genome reduction in various evolutionary scenarios .

What experimental approaches can be used to assess the functional role of Apocytochrome f in Cuscuta exaltata's parasitic lifestyle?

Comprehensive experimental approaches:

  • Genetic manipulation strategies:

    • Apply the Agrobacterium-mediated transformation protocol developed for Cuscuta species

    • Create knockdown/CRISPR systems targeting petA expression

    • Develop complementation assays with wild-type and mutant versions

  • Physiological assessment methods:

    • Measure photosynthetic electron transport rates using PAM fluorometry

    • Analyze carbon isotope discrimination (δ13C) to quantify photosynthetic contribution to carbon budget

    • Compare growth rates and infection success of wild-type vs. petA-modified plants

    • Evaluate host dependence by controlling nutrient acquisition from host

  • Experimental design for functional studies:

    Stage 1: Transformation and verification

    • Transform C. exaltata using Agrobacterium with petA-targeting constructs

    • Verify successful transformation using fluorescent markers

    • Quantify petA expression levels using RT-qPCR

    Stage 2: Physiological characterization

    • Measure photosynthetic parameters in wild-type and modified plants

    • Assess growth on various host species

    • Evaluate haustorial development and attachment efficiency

    Stage 3: Host interaction analysis

    • Compare metabolite profiles at host-parasite interface

    • Analyze transcriptional changes in both host and parasite

    • Track resource allocation using labeled compounds

These approaches would provide comprehensive insights into how Apocytochrome f contributes to C. exaltata's unique ecological niche as a partially photosynthetic parasite .

How might studying the petA gene in Cuscuta exaltata inform strategies for managing parasitic plant infestations?

Research on petA in C. exaltata has potential applications for parasitic plant management:

Application pathways:

  • Target identification for selective control:

    • The retention of photosynthetic genes like petA in C. exaltata identifies potential molecular targets

    • Compounds disrupting specific aspects of photosynthesis could selectively affect partially photosynthetic parasites

    • Comparative analysis with host plants could identify parasite-specific vulnerabilities

  • Management strategy development:

    • Understanding the relative contribution of photosynthesis to C. exaltata's energy budget informs timing of control measures

    • If photosynthesis is critical during specific life stages, targeted interventions may be more effective

    • The specificity of host-parasite interactions may suggest cultural control methods

  • Risk assessment framework:

    • Knowledge of photosynthetic capacity helps predict invasion potential in new environments

    • The balance between host dependency and photosynthetic ability influences spread patterns

    • This information can prioritize management efforts toward the most problematic species

While C. exaltata itself is native to parts of the United States, the research approaches could be applied to invasive Cuscuta species like C. reflexa, which has been identified as problematic in Kenya and threatens food security and biodiversity .

What methods can be used to study the three-dimensional structure of Cuscuta exaltata Apocytochrome f and how might this inform our understanding of its function?

Structural biology approaches:

The structural insights gained would help identify:

  • Regions critical for electron transfer function

  • Conserved vs. divergent features compared to non-parasitic relatives

  • Potential adaptation signatures related to the parasitic lifestyle

  • Interaction surfaces with other components of the electron transport chain

This structural knowledge would enhance our understanding of how C. exaltata has maintained functional photosynthetic machinery despite its parasitic lifestyle and illuminate the molecular basis of this evolutionary compromise.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.