Recombinant Cuscuta exaltata ATP synthase subunit a, plastid (atpI)

Shipped with Ice Packs
In Stock

Description

Role in Plastid ATP Synthase

In Cuscuta exaltata, the ATP synthase complex remains functional despite the plant’s parasitic lifestyle, which typically reduces reliance on photosynthesis. The atpI subunit is critical for:

  • Proton Translocation: Subunit a forms part of the proton channel in the F₀ sector, enabling the translocation of protons across the membrane to generate the proton gradient .

  • C-Ring Assembly: In bacterial systems, AtpI (equivalent to subunit a) is implicated in the oligomerization of the c-ring, a process essential for rotor formation . While Cuscuta’s plastid ATP synthase structure is not fully characterized, the recombinant subunit a likely mirrors this role.

Comparative Genomics Insights:

  • Cuscuta plastid genomes retain photosynthetic and photorespiratory genes under strong selective pressure, despite reduced metabolic dependence on photosynthesis .

  • The atpI gene in Cuscuta shows conserved sequence alignment with non-parasitic relatives like Ipomoea, though parasitic species exhibit distinct plastid genome rearrangements .

Research Applications

The recombinant subunit a is utilized in biochemical and structural studies to investigate:

  • ATP Synthase Assembly: The His-tagged protein facilitates purification and reconstitution into liposomes for functional assays, enabling studies on proton translocation efficiency .

  • Parasite-Host Interactions: Insights into how parasitic plants maintain functional plastids could inform strategies to develop herbicides or improve crop resilience .

Experimental Findings:

  • Stability and Activity: The purified protein demonstrates >90% purity and retains activity when stored at -20°C/-80°C, though repeated freeze-thaw cycles reduce stability .

  • Proton-Motive Force Sensitivity: While not directly tested in Cuscuta, analogous ATP synthases in archaea operate at low driving forces (90–150 mV), suggesting potential adaptability in parasitic environments .

Comparative Analysis of Plastid ATP Synthase Subunits

SubunitGeneFunctionPresence in Cuscuta
αatpAF₁ domain, nucleotide bindingPresent (e.g., A8W3H5)
βatpBCatalytic subunit in F₁Present (e.g., A8W3H6)
aatpIF₀ proton channelPresent (A8W3B2)
batpFPeripheral stalk, stabilizes F₀-F₁Present (e.g., A8W3H6)
catpEC-ring, proton translocationPresent (e.g., A8W3H7)

Challenges and Future Directions

  • Functional Redundancy: In some bacterial systems, atpI is dispensable for ATP synthase function, raising questions about its necessity in Cuscuta .

  • Structural Elucidation: High-resolution crystallography or cryo-EM studies are needed to resolve the interaction between subunit a and other F₀ components in plastid ATP synthases.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill them accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpI; ATP synthase subunit a, plastid; ATP synthase F0 sector subunit a; F-ATPase subunit IV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Cuscuta exaltata (Tall dodder)
Target Names
atpI
Target Protein Sequence
MDVLSCSINTLKGLYDISGVEVGQHFYWQIGDFLVHGQVLITSWVVIAILLGSATVAVRN PQTIPTGGQNFFEYVLEFIRDVSKTQIGEEYGPWVPFIGTMFLFIFVSNWSGALLPWKIL QLPHGELAAPTNDINTTVALALLTSAAYFYAGILKKGLGYFEKYIKPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPSVVPIPVMLLGLFTSGIQALIFATLAAAYIG ESMEGHL
Uniprot No.

Target Background

Function
This protein is a key component of the proton channel and plays a direct role in proton translocation across the membrane.
Protein Families
ATPase A chain family
Subcellular Location
Plastid membrane; Multi-pass membrane protein.

Q&A

What is the atpI gene in Cuscuta exaltata and why is it significant?

The atpI gene in Cuscuta exaltata encodes subunit a of the ATP synthase complex located in the plastid. This gene is part of the plastid genome that has been retained despite the plant's parasitic lifestyle. The significance of atpI lies in its essential role in the ATP synthase complex, which functions as a rotary nano-machine where proton translocation through the F₀ domain leads to rotation of a membrane-embedded ring-like rotor .

The a-subunit specifically provides the proton path from outside the membrane surface to the carboxylates of interacting c-subunits of the rotor . In Cuscuta exaltata, the retention of atpI and other photosynthetic genes suggests that despite its parasitic nature, this species maintains functional photosynthetic machinery, unlike some other parasites that have lost these genes completely .

How does the plastid genome of Cuscuta exaltata differ from other parasitic plants?

Cuscuta exaltata has undergone significant plastid genome modifications compared to non-parasitic relatives, yet retains more photosynthetic functionality than many other parasites. Key differences include:

  • Gene retention pattern: Unlike Epifagus virginiana (another sequenced parasitic plant), C. exaltata has lost all ndh genes but retains photosynthetic and photorespiratory genes that evolve under strong selective constraint .

  • Structural rearrangements: The plastid genome of C. exaltata shows several structural changes, including a constricted Large Single Copy (LSC) end of the Inverted Repeat (IR) region. This constriction is more dramatic than in other species, with rpl2, trnI, and over half of ycf2 falling outside the IR .

  • Inversion events: C. exaltata exhibits two segmental inversion events - one from trnV-UAC to psbE in the LSC region, and another in the Small Single Copy (SSC) region encompassing ccsA and trnL-UAG genes .

  • Size reduction: While maintaining photosynthetic capacity, the C. exaltata plastid genome has undergone size reduction compared to non-parasitic relatives like Ipomoea purpurea .

These differences reflect the evolutionary trajectory of C. exaltata as it adapted to a partially heterotrophic lifestyle while maintaining photosynthetic capability.

What is the structure and function of ATP synthase subunit a in plastids?

ATP synthase subunit a is a critical stator component of the F₀ sector of ATP synthase with several important structural and functional features:

  • Membrane topology: The subunit is embedded in the membrane and interacts with the c-ring rotor.

  • Proton channel formation: The a-subunit provides the essential proton pathway from the outside of the membrane to the c-subunits of the rotor .

  • Functional domains: While no high-resolution structural data are yet available for the a-subunit, extensive biochemical and genetic evidence indicates it plays crucial roles in the proton translocation mechanism .

  • Interaction with c-subunits: The a-subunit participates in the critical step of de-protonation of c-subunits after full rotation, which is essential for coupling ATP synthesis to the proton motive force (PMF) .

  • Conservation: The a-subunit typically shows evolutionary conservation in photosynthetic organisms but may contain specific adaptations in different lineages. For example, in alkaliphiles, a lysine residue is found in the putative proton uptake pathway of the ATP synthase a-subunit .

The functional integrity of subunit a is critical for ATP synthase activity and therefore essential for energy production in plastids.

What molecular techniques are commonly used to identify and characterize Cuscuta species?

Researchers employ several molecular techniques to identify and characterize Cuscuta species, which can be adapted for studying specific genes like atpI:

  • PCR amplification of marker genes: Studies commonly target plastid genes like rbcL (750 bp fragments), as well as nuclear genes like ITS (575 bp fragments) and plastid trnL genes (427 bp fragments) .

  • DNA sequence analysis: Following PCR amplification, products are purified and sequenced to determine species identity .

  • Comparative genomics: Sequence data is compared with existing databases using BLAST analysis to confirm species identification and explore evolutionary relationships .

  • Phylogenetic analysis: Sequences with 90% similarity are compared to determine evolutionary relationships among Cuscuta species and related taxa .

These techniques provide a foundation for more specific analyses of genes like atpI in Cuscuta exaltata. For studying the recombinant atpI protein specifically, researchers would isolate the gene using similar PCR-based approaches before proceeding to expression and characterization studies.

How has the plastid genome evolved in parasitic plants like Cuscuta?

The plastid genome evolution in parasitic plants like Cuscuta follows distinct patterns reflecting adaptations to heterotrophic lifestyles:

  • Directional downsizing: Parasitic plant plastid genomes undergo directional reduction as dependence on photosynthesis decreases. This reduction follows a predictable pattern, with certain genes lost before others .

  • Gene loss pattern: The ndh genes (encoding NADH dehydrogenase) are typically the first functional genes lost during the transition to parasitism in Cuscuta . More extensive gene loss occurs later in evolution.

  • Selective constraint: Despite substantial genome reduction, photosynthetic genes in Cuscuta remain under the highest evolutionary constraint among all plastid genes, suggesting they maintain important functions .

  • Retention of key genes: Even in highly reduced plastid genomes, certain genes like accD (acetyl-CoA carboxylase subunit) are commonly retained, indicating that lipid biosynthesis remains an important function of plastids in parasitic species .

  • Lineage-specific differences: Different parasitic lineages show unique patterns of gene loss. For example, Cuscuta obtusiflora has lost all genes for plastid-encoded RNA polymerase while retaining photosynthetic genes, whereas Epifagus virginiana has lost all photosynthesis-related genes .

This evolutionary trajectory provides insight into the functional significance of retained genes like atpI and suggests potential alternative functions beyond photosynthesis.

What challenges are associated with expressing recombinant Cuscuta exaltata atpI protein?

Expression of recombinant C. exaltata atpI presents several technical challenges that researchers must address:

  • Membrane protein solubility: As a membrane-embedded component of ATP synthase, the a-subunit contains hydrophobic domains that make it difficult to express in soluble form. Researchers must optimize expression systems using specialized detergents or membrane-mimetic environments.

  • Structural integrity: Maintaining proper folding of the a-subunit is critical, as improper folding can lead to aggregation or loss of function. This requires careful selection of expression hosts and conditions.

  • Assembly factor requirements: ATP synthase assembly involves multiple factors. The search results indicate that complex complements of ATP synthase assembly factors are retained in most eukaryotic lineages . Successful expression may require co-expression of these factors or optimization of conditions that promote proper folding without them.

  • Gene transfer considerations: In Cuscuta exaltata, unlike some green algae where all ATP synthase subunits are nuclear-encoded, several subunits may remain plastid-encoded . This organellar location must be considered when designing expression systems.

  • Post-translational modifications: Any required post-translational modifications must be accounted for in the expression system selection, as these may be essential for function.

To overcome these challenges, researchers might employ specialized expression systems like cell-free translation in the presence of lipids, use of fusion partners to enhance solubility, or expression in organelle-containing systems that provide appropriate assembly factors.

How does the structure and function of ATP synthase a-subunit in Cuscuta exaltata compare to other organisms?

The ATP synthase a-subunit in Cuscuta exaltata likely shows both conservation and lineage-specific adaptations compared to other organisms:

Understanding these comparative aspects could provide insights into how ATP synthase structure and function adapt during the transition to parasitism while maintaining essential energy production capabilities.

What experimental approaches are optimal for characterizing recombinant atpI protein function?

Characterizing recombinant atpI protein function requires multiple complementary approaches:

These approaches would enable comprehensive characterization of the recombinant atpI protein's structure, function, and interactions in the context of ATP synthase activity.

How can insights from recombinant atpI studies inform our understanding of plastid evolution in parasitic plants?

Studies of recombinant atpI from C. exaltata can provide critical insights into plastid evolution during the transition to parasitism:

  • Selective pressure analysis: By comparing the sequence and function of recombinant atpI with orthologs from non-parasitic relatives, researchers can identify changes in selective pressure that accompany the transition to parasitism. Evidence already shows that photosynthetic genes remain under high constraint in Cuscuta despite parasitism .

  • Functional shifts: Analysis of recombinant atpI can reveal whether the protein has acquired modified functions in parasitic plants. For example, the high conservation of photosynthetic genes in Cuscuta might indicate roles beyond photosynthesis, potentially in lipid biosynthesis .

  • Molecular clock applications: The rate of sequence evolution in atpI compared to other genes can serve as a molecular clock to date the transition to parasitism and subsequent adaptations in the Cuscuta lineage.

  • Structural adaptations: Structural analysis of recombinant atpI might reveal adaptations specific to parasitic lifestyle, such as changes in proton translocation efficiency or interactions with other ATP synthase components.

  • Comparative genomics insights: The retention of atpI in Cuscuta while other genes are lost suggests its essential function. Understanding why certain genes like atpI are retained while others are lost informs models of plastid genome reduction during the evolution of parasitism .

These insights would contribute to broader understanding of how essential cellular machinery adapts during major ecological transitions like the shift from autotrophy to heterotrophy.

What alternative functions might ATP synthase serve in parasitic plants like Cuscuta exaltata?

The strong conservation of ATP synthase components including atpI in Cuscuta species suggests alternative or additional functions beyond traditional photosynthetic ATP production:

  • Lipid biosynthesis support: A compelling hypothesis is that ATP synthase components, including RuBisCo and ATP synthase, are retained primarily for their role in lipid biosynthesis rather than carbohydrate production through the Calvin Cycle . This is supported by the observation that accD, a subunit of acetyl-CoA carboxylase involved in lipid biosynthesis, is one of the few genes consistently retained in parasitic plastids .

  • ATP-dependent processes: Even in parasitic plants, plastids may require ATP for various metabolic processes. The ATP synthase might function in reverse as an ATP-driven proton pump to maintain membrane potential necessary for other processes.

  • Signaling functions: The proton gradient maintained by ATP synthase might serve signaling functions, potentially coordinating nuclear and plastid activities even in the absence of full photosynthetic capacity.

  • Evolutionary intermediates: The ATP synthase components might represent evolutionary intermediates as the plastid transitions to new functions. Their retention might reflect ongoing adaptation where complete loss has not yet been selectively advantageous.

  • Host interaction roles: ATP synthase components might play roles in host-parasite interactions, potentially influencing energy exchange between Cuscuta and its host plants.

The consistent finding that photosynthetic genes remain the most conserved genes in Cuscuta plastid genomes, despite reduced photosynthetic dependence, strongly supports these alternative functions and warrants further investigation using recombinant proteins like atpI .

What expression systems are most suitable for recombinant Cuscuta exaltata atpI production?

Selecting the appropriate expression system for recombinant atpI is critical for obtaining functional protein:

  • Bacterial expression systems:

    • E. coli C41(DE3) or C43(DE3) strains: Specifically designed for membrane protein expression

    • Fusion with solubility tags (MBP, SUMO, Trx) to improve folding and solubility

    • Codon optimization for E. coli expression considering the distinct codon usage in plant plastid genes

  • Eukaryotic expression systems:

    • Chloroplast transformation in model plants (tobacco, Chlamydomonas): Provides native-like membrane environment

    • Yeast expression systems (P. pastoris): Better for membrane proteins than bacterial systems

    • Insect cell expression (Sf9, High Five): Supports complex membrane protein expression

  • Cell-free expression systems:

    • Wheat germ extract with added lipids/detergents: Avoids toxicity issues

    • E. coli extract supplemented with nanodiscs or liposomes: Allows direct incorporation into membrane-mimetic environments

  • Methodology considerations:

    • Temperature optimization: Lower temperatures (16-20°C) often improve membrane protein folding

    • Detergent screening: Systematic testing of detergents for extraction and purification

    • Lipid composition: Matching lipid environment to native plastid membranes

Each system offers advantages and limitations, necessitating empirical testing to determine optimal conditions for functional atpI production.

What purification strategies are effective for recombinant ATP synthase subunits?

Purification of membrane proteins like ATP synthase subunit a requires specialized approaches:

  • Solubilization strategies:

    • Detergent selection: Mild detergents like DDM, LMNG, or digitonin preserve protein-protein interactions

    • Native membrane extraction: Gradual solubilization preserves protein complexes

    • Lipid:protein ratio optimization: Critical for maintaining stability during extraction

  • Affinity purification approaches:

    • Poly-histidine tags: Position tags at termini least likely to disrupt function

    • Strep-tag II or FLAG tag systems: Gentler elution conditions than His-tag

    • Split intein approaches: Tag removal without protease treatment

  • Size exclusion and ion exchange chromatography:

    • Sequential chromatography steps to remove contaminants

    • Buffer optimization to maintain protein stability

  • Specialized membrane protein techniques:

    • Styrene maleic acid lipid particles (SMALPs): Extract membrane proteins with surrounding lipids

    • Amphipol stabilization: Replace detergents with amphipathic polymers for increased stability

    • Reconstitution into nanodiscs: Provide native-like membrane environment

  • Quality control assessments:

    • Dynamic light scattering: Monitor protein aggregation

    • Circular dichroism: Verify secondary structure integrity

    • Functional assays: Confirm activity at each purification step

These strategies must be optimized iteratively for the specific characteristics of atpI from C. exaltata, considering its hydrophobicity profile and interaction partners.

How can researchers validate the functionality of recombinant atpI protein?

Validating functionality of recombinant atpI protein requires multiple complementary approaches:

  • Proton translocation assays:

    • pH-sensitive fluorescent dyes (ACMA, pyranine) to monitor proton movement

    • Reconstitution with partner subunits in proteoliposomes

    • Patch clamp measurements of single channel conductance

  • ATP synthesis/hydrolysis coupling:

    • Luminescence-based ATP detection assays

    • Oxygen consumption measurements when coupled to electron transport

    • P:O ratio determination (ATP synthesized per oxygen consumed)

  • Structural integrity assessment:

    • Limited proteolysis to verify proper folding

    • Native gel electrophoresis to confirm complex assembly

    • Cross-linking studies to verify interactions with c-ring and other subunits

  • Complementation studies:

    • Expression in atpI-deficient bacterial or yeast strains

    • Rescue of growth phenotypes on non-fermentable carbon sources

    • In organello complementation in isolated chloroplasts

  • Biophysical characterization:

    • EPR spectroscopy with spin-labeled residues to monitor conformational changes

    • FRET analysis of subunit interactions within the complex

    • Hydrogen-deuterium exchange to identify solvent-accessible regions

These approaches collectively provide a comprehensive assessment of whether the recombinant atpI protein maintains its native structural and functional properties.

How should sequence conservation data be interpreted for parasitic plant ATP synthase components?

Interpretation of sequence conservation in parasitic plant ATP synthase components requires careful consideration of evolutionary context:

  • Differential selective pressures:

    • Higher conservation of photosynthetic genes in Cuscuta suggests persistent function despite parasitism

    • Compare dN/dS ratios (nonsynonymous to synonymous substitution rates) across functional categories of genes

  • Conservation patterns across species:

    SpeciesatpI ConservationPhotosynthetic CapacityReference
    C. exaltataHighVisible chlorophyll throughout stems
    C. obtusifloraModerateGreen pigmentation mainly in inflorescences
    Epifagus virginianaLostNo photosynthetic capacity
  • Functional domain analysis:

    • Critical residues for proton translocation likely show higher conservation

    • Membrane-spanning regions typically evolve more slowly than exposed loops

    • Residues at interaction interfaces with other subunits often highly conserved

  • Lineage-specific adaptations:

    • Unique substitutions in parasitic lineages may indicate adaptive changes

    • Compare with similar modifications in other ATP synthases (e.g., the lysine residue in alkaliphile a-subunits)

  • Correlation with structural features:

    • Map conservation onto predicted structural models

    • Identify conservation hotspots that may indicate functional importance

These interpretative frameworks help distinguish between sequence changes representing neutral drift, relaxed selection, or adaptive evolution in parasitic plant ATP synthases.

What bioinformatic approaches are valuable for analyzing ATP synthase evolution in parasitic plants?

Several bioinformatic approaches provide valuable insights into ATP synthase evolution in parasitic plants:

  • Phylogenetic methods:

    • Maximum likelihood and Bayesian inference to reconstruct evolutionary relationships

    • Ancestral sequence reconstruction to identify key evolutionary transitions

    • Branch-site models to detect episodic positive selection

  • Structural prediction and analysis:

    • Homology modeling based on related ATP synthase structures

    • Molecular dynamics simulations to assess functional implications of sequence changes

    • Coevolution analysis to identify co-varying residues indicating functional relationships

  • Comparative genomics:

    • Synteny analysis to examine conservation of gene order and context

    • Detection of segmental inversions and gene rearrangements that may affect expression

    • Identification of lost genes and pseudogenization events

  • Selection analysis:

    • Calculation of Ka/Ks ratios across different lineages to quantify selection pressure

    • Sliding window analysis to identify regions under different selective regimes

    • McDonald-Kreitman tests to assess adaptive evolution

  • RNA-seq integration:

    • Correlation of sequence conservation with expression patterns

    • Identification of potential compensatory nuclear-encoded factors

These approaches, applied systematically to atpI and other ATP synthase components, can reveal how these essential complexes adapt during the transition to parasitism while maintaining critical cellular functions.

How can researchers address contradictory findings in ATP synthase functional studies?

Researchers may encounter contradictory findings when studying ATP synthase function in parasitic plants. Here are methodological approaches to address such contradictions:

  • Standardization of experimental conditions:

    • Use consistent buffer compositions, pH, and temperature conditions

    • Standardize protein purification protocols to minimize variation

    • Establish reference standards for activity measurements

  • Multi-method validation:

    • Employ multiple independent techniques to assess the same parameter

    • Compare in vitro and in vivo approaches when possible

    • Validate recombinant protein findings with native protein studies

  • Systematic variable testing:

    VariableExperimental RangeControl ConditionMeasurement
    pH6.0-8.57.4ATP synthesis rate
    Temperature15-37°C25°CProton translocation
    Lipid compositionVarying PE:PG:CL ratiosNative compositionComplex stability
  • Statistical approaches:

    • Meta-analysis of multiple studies to identify consistent trends

    • Bayesian analysis incorporating prior probability distributions

    • Sensitivity analysis to identify variables with greatest impact

  • Resolution through evolutionary context:

    • Compare findings across related species with different degrees of parasitism

    • Consider tissue-specific differences in ATP synthase function

    • Examine developmental stages for functional transitions

By systematically addressing variables and employing multiple complementary approaches, researchers can resolve contradictions and develop a more comprehensive understanding of ATP synthase function in parasitic plants.

What emerging technologies could advance research on recombinant Cuscuta exaltata atpI?

Several cutting-edge technologies hold promise for advancing atpI research:

  • Structural biology innovations:

    • Cryo-electron microscopy advances enabling atomic resolution of membrane protein complexes

    • Integrative structural biology combining multiple data types (X-ray, NMR, cross-linking)

    • Serial femtosecond crystallography at X-ray free electron lasers for membrane proteins

  • Single-molecule techniques:

    • High-speed atomic force microscopy to visualize ATP synthase dynamics

    • Single-molecule FRET to track conformational changes during function

    • Nanodiscs combined with single-molecule force spectroscopy

  • Advanced genetic tools:

    • CRISPR-Cas9 editing of plastid genomes to create precise modifications

    • Synthetic biology approaches to reconstitute minimal ATP synthase systems

    • Expanded genetic code incorporation of non-canonical amino acids for site-specific probes

  • Computational advances:

    • Machine learning for improved structure prediction and functional annotation

    • Enhanced molecular dynamics simulations with longer timescales

    • Quantum mechanical/molecular mechanical (QM/MM) approaches for proton transfer modeling

  • Imaging technologies:

    • Super-resolution microscopy to visualize ATP synthase distribution in plastids

    • Correlative light and electron microscopy to link structure and function

    • Label-free imaging techniques like coherent Raman scattering microscopy

These emerging technologies will enable researchers to address fundamental questions about atpI structure, function, and evolution with unprecedented resolution and precision.

What are the implications of ATP synthase research for understanding broader evolutionary transitions in plants?

Research on ATP synthase in parasitic plants has significant implications for understanding evolutionary transitions:

  • Evolutionary flexibility of essential complexes:

    • ATP synthase research reveals how fundamentally important protein complexes can adapt during major ecological transitions

    • Insights into which components are most flexible versus most constrained can inform models of evolutionary innovation

  • Organellar genome reduction:

    • The patterns of gene retention and loss in plastids of parasitic plants inform models of organellar genome evolution

    • ATP synthase component retention despite genome reduction highlights essential functions beyond photosynthesis

  • Metabolic repurposing:

    • Evidence that photosynthetic machinery may be repurposed for lipid biosynthesis in parasitic plants suggests mechanisms for functional transitions during evolution

    • Understanding how complexes acquire new functions informs models of evolutionary innovation

  • Nuclear-plastid coordination:

    • Changes in ATP synthase subunit encoding location (plastid to nuclear genome) provide insights into organellar integration

    • Patterns seen in Cuscuta can be compared with similar transitions in other lineages

  • Convergent evolution:

    • Comparison of ATP synthase adaptations in distantly related parasitic lineages can reveal constraints and opportunities in convergent evolution

    • Similarities between Cuscuta and other parasites like Epifagus offer natural experiments in parallel evolution

These insights from ATP synthase research contribute to our broader understanding of how essential cellular machinery evolves during major ecological and metabolic transitions in plants.

How might interdisciplinary approaches enhance ATP synthase subunit research?

Interdisciplinary approaches can significantly advance ATP synthase research in parasitic plants:

  • Integrating structural biology with evolutionary genomics:

    • Mapping selective pressures onto structural models to identify functional constraints

    • Using ancestral sequence reconstruction with structural biology to understand evolutionary trajectories

    • Combining phylogenetics with biophysical studies to correlate sequence changes with functional shifts

  • Combining biochemistry with ecology:

    • Relating ATP synthase adaptations to ecological niches of different Cuscuta species

    • Connecting host specificity with energy acquisition strategies

    • Examining ATP synthase function across different host-parasite interfaces

  • Merging synthetic biology with physiology:

    • Engineering minimal ATP synthase complexes to test hypotheses about essential components

    • Creating chimeric complexes to identify lineage-specific adaptations

    • Developing in vitro systems that mimic parasitic plant energy metabolism

  • Linking bioinformatics with experimental biology:

    • Using machine learning to predict functional consequences of sequence variations

    • Developing computational models of ATP synthase function validated by experimental approaches

    • Applying network analysis to understand coevolution of interacting components

  • Combining traditional knowledge with modern science:

    • Incorporating indigenous knowledge about Cuscuta species distribution and host range

    • Exploring traditional uses of parasitic plants that might relate to biochemical properties

    • Integrating historical observations with modern molecular data

These interdisciplinary approaches provide complementary perspectives that can resolve complex questions about ATP synthase function and evolution in parasitic plants that would be difficult to address through any single discipline.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.