Recombinant Cuscuta exaltata Cytochrome c biogenesis protein ccsA (ccsA)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Cuscuta exaltata Cytochrome c Biogenesis Protein ccsA (ccsA)

Recombinant Cuscuta exaltata cytochrome c biogenesis protein ccsA (ccsA) is a genetically engineered protein derived from the parasitic plant Cuscuta exaltata. This protein is critical for cytochrome c biogenesis, a process essential for electron transport in plastids. The recombinant form is produced in E. coli with an N-terminal His-tag for purification and is used in biochemical studies to explore plastid genome evolution, particularly in parasitic plants .

Role in Plastid Genome Evolution

Cuscuta exaltata retains a reduced plastid genome (~121–125 kbp) compared to photosynthetic relatives, with losses primarily in ndh (chlororespiratory) genes and non-coding regions . Key genomic features include:

  • Sequence Inversions:

    • A segmental inversion in the SSC region encompassing ccsA and trnL-UAG .

    • These inversions border regions once containing ndh genes, suggesting structural rearrangements linked to plastid genome degradation .

  • Gene Retention:

    • Retains photosynthetic and photorespiratory genes despite parasitism, indicating residual plastid functionality .

Chloroplast Genome Rearrangements

The plastid genome of C. exaltata exhibits:

  • IR Constriction: The inverted repeat (IR) is contracted, excluding rpl2, trnI, and part of ycf2 .

  • Phylogenetic Clustering:

    • Chloroplast genomes of Cuscuta species, including C. exaltata, cluster with Ipomoea in phylogenetic analyses despite taxonomic divergence .

Experimental Use

  • ELISA Kits: Recombinant ccsA is utilized in enzyme-linked immunosorbent assays (ELISA) for detecting cytochrome c biogenesis-related antibodies .

  • Biochemical Studies:

    • Investigating plastid gene expression in parasitic plants.

    • Exploring cytochrome c biogenesis mechanisms in reduced plastid systems.

Limitations

  • Limited Functional Data: Direct evidence of ccsA’s biochemical activity in cytochrome c maturation is sparse .

  • Genomic Complexity: Structural inversions and IR contractions complicate homology-based functional predictions .

Comparative Analysis of SSRs in Cuscuta Species

Simple sequence repeats (SSRs) in plastid genomes are critical for genetic diversity studies. For C. exaltata:

SSR TypeCount
Mononucleotide (A/T)31
Dinucleotide0
Polynucleotide0

Note: SSRs are predominantly mononucleotide (A/T), with C. exaltata showing 31 SSRs, including 9 A-type and 3 T-type repeats .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery estimates, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein with deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
ccsA; Cytochrome c biogenesis protein CcsA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-308
Protein Length
full length protein
Species
Cuscuta exaltata (Tall dodder)
Target Names
ccsA
Target Protein Sequence
MIVSTLEHILTHISFSIVSILITIKLRIFLADEIKKLYDSSERGMLVTFFCITGLLATHW IYLGHFPLSDLSESLIFLSWSFALIHSIAYFTKNTKLLSTITSQSTVFTQGFATSGILTE IQKSSILVPALQSEWLIMHVSLMILGYAALLCGSLLSVALMVITFRKDGKFFSKSKDFLF TEIFYKKIFVFNYNNYYKTQLIQELDFWSYQVIGLGFIFLTIGILSGAVWANEAWGSYWS WDPKETWAFITWIVFAIYLHTRKKRSLQGTNSAIVASIGFLIIWICYFGVNLVGLGLHSY GSFPSTSN
Uniprot No.

Target Background

Function
This protein plays a crucial role in the biogenesis of c-type cytochromes (cytochrome c6 and cytochrome f), specifically during the heme attachment step.
Protein Families
CcmF/CycK/Ccl1/NrfE/CcsA family
Subcellular Location
Plastid membrane; Multi-pass membrane protein.

Q&A

What is Cytochrome c biogenesis protein ccsA and what is its function in Cuscuta exaltata?

Cytochrome c biogenesis protein ccsA (ccsA) is an integral membrane protein involved in the assembly and maturation of c-type cytochromes in Cuscuta exaltata, a parasitic plant commonly known as tall dodder. The protein plays a crucial role in the heme attachment process during cytochrome c synthesis, which is essential for electron transport in respiratory and photosynthetic chains. In parasitic plants like Cuscuta, which have evolved modified biological pathways due to their parasitic lifestyle, ccsA may have adapted specific functions related to energy metabolism during host interaction . The protein contains transmembrane domains that facilitate its function in heme transport across membranes, making it vital for cellular respiration processes.

How does recombinant ccsA protein differ from native ccsA in Cuscuta exaltata?

The recombinant Cuscuta exaltata ccsA protein differs from the native form in several ways:

  • Expression system: The recombinant protein is expressed in E. coli, which may result in different post-translational modifications compared to the native protein expressed in plant cells .

  • Affinity tag: The recombinant protein contains an N-terminal His-tag, which is absent in the native form. This tag facilitates purification but may affect protein folding or function in certain applications .

  • Glycosylation pattern: E. coli lacks the machinery for plant-specific glycosylation, potentially resulting in differences in glycosylation patterns between recombinant and native proteins.

  • Solubility and folding: The recombinant protein may have different solubility characteristics and potential differences in tertiary structure due to the expression in a prokaryotic system rather than the original eukaryotic environment.

These differences are important considerations when using recombinant ccsA for research purposes, as they may influence experimental outcomes and interpretations.

What experimental approaches can be used to investigate the interaction between ccsA and other cytochrome c biogenesis proteins in Cuscuta?

Several experimental approaches can be employed to investigate protein-protein interactions involving ccsA:

  • Co-immunoprecipitation (Co-IP): Using antibodies against the His-tag of recombinant ccsA to pull down protein complexes, followed by mass spectrometry identification of interacting partners.

  • Yeast two-hybrid (Y2H) assays: Creating fusion proteins with ccsA and potential interacting partners to detect protein interactions through reporter gene activation.

  • Bimolecular Fluorescence Complementation (BiFC): Fusing complementary fragments of fluorescent proteins to ccsA and potential partners to visualize interactions in vivo.

  • Surface Plasmon Resonance (SPR): Measuring binding kinetics between immobilized ccsA and other proteins in real-time.

  • Proximity-dependent biotin identification (BioID): Fusing ccsA to a biotin ligase to identify proteins in close proximity in vivo.

For Cuscuta specifically, these approaches can be adapted using the transformation protocols recently developed for Cuscuta species that allow for expression of tagged proteins in planta . These techniques could reveal novel interactions between ccsA and other components involved in cytochrome c biogenesis or parasitic plant-specific interactions.

How does the ccsA protein in Cuscuta exaltata compare to homologous proteins in other parasitic and non-parasitic plants?

Comparative analysis of ccsA proteins across different plant species reveals evolutionary adaptations:

SpeciesSequence Identity (%)Key DifferencesFunctional Implications
Cuscuta exaltata100 (reference)-Parasitic lifestyle adaptation
Other Cuscuta species85-95Minor variations in transmembrane domainsSpecies-specific host interactions
Non-parasitic Convolvulaceae70-80Differences in heme-binding regionsStandard photosynthetic function
Other parasitic plants60-75Varied transmembrane organizationConvergent evolution for parasitism
Non-parasitic angiosperms50-65Significant differences in N-terminal regionConventional photosynthetic roles

Cuscuta species show adaptations in their ccsA proteins that may reflect their parasitic lifestyle, including modifications to domains involved in energy metabolism . These adaptations could be related to the reduced photosynthetic capacity in Cuscuta and increased reliance on host plants for resources. Phylogenetic analysis suggests that ccsA evolution in Cuscuta correlates with the development of parasitic traits and host specificity patterns.

What role might ccsA play in the parasitic lifestyle of Cuscuta exaltata during host interaction?

The ccsA protein may play several significant roles in Cuscuta's parasitic lifestyle:

  • Energy metabolism adaptation: During host attachment and nutrient acquisition, ccsA's function in cytochrome c biogenesis could be crucial for maintaining efficient electron transport chains adapted to parasitism .

  • Haustorial development: The infection organs (haustoria) formed by Cuscuta require significant metabolic activity and cellular reorganization, potentially involving ccsA-dependent processes .

  • Stress response: Host defense responses create oxidative stress conditions during infection, and cytochromes are important in managing redox balance.

  • Signaling pathways: Cytochrome c is involved in programmed cell death signaling, which may be regulated during the infection process to manipulate host responses.

Recent transformation studies with Cuscuta species have shown that the cells below the adhesive disk's epidermis are particularly susceptible to genetic manipulation, suggesting these cells may have unique metabolic activities during host infection . The ccsA protein could be differentially regulated in these cells to support the parasitic interaction, making it a potential target for understanding the molecular basis of parasitism in Cuscuta.

What are the optimal conditions for expression and purification of recombinant Cuscuta exaltata ccsA protein?

Optimized expression and purification protocols for recombinant ccsA protein include:

  • Expression System Selection:

    • E. coli BL21(DE3) strain is commonly used for membrane protein expression

    • Induction with 0.1-0.5 mM IPTG at lower temperatures (16-20°C) improves folding

    • Co-expression with chaperones may enhance proper folding

  • Purification Strategy:

    • Initial lysis in Tris/PBS buffer with 1% detergent (typically DDM or LDAO)

    • IMAC purification using Ni-NTA columns with imidazole gradient elution

    • Further purification by size exclusion chromatography

  • Storage Conditions:

    • Store in Tris/PBS-based buffer with 6% trehalose at pH 8.0

    • Aliquot and store at -20°C/-80°C with 50% glycerol for long-term stability

    • Avoid repeated freeze-thaw cycles

  • Quality Control:

    • Verify purity by SDS-PAGE (>90% purity expected)

    • Confirm identity by Western blot using anti-His antibodies

    • Assess functionality through heme-binding assays

For membrane proteins like ccsA, maintaining proper folding and stability during purification is crucial, so detergent selection and buffer optimization are critical factors for successful preparation.

What techniques can be used to assess the functional activity of the recombinant ccsA protein?

Several assays can be employed to evaluate the functional activity of recombinant ccsA:

  • Heme Binding Assays:

    • UV-visible spectroscopy to monitor characteristic absorbance changes upon heme binding

    • Fluorescence quenching assays to measure heme-protein interactions

    • Isothermal titration calorimetry (ITC) for binding affinity determination

  • Reconstitution Studies:

    • Liposome reconstitution to assess membrane integration

    • Proteoliposome-based assays to measure heme transport activity

    • In vitro cytochrome c assembly assays with partner proteins

  • Structural Integrity Assessment:

    • Circular dichroism (CD) spectroscopy to analyze secondary structure

    • Limited proteolysis to probe proper folding

    • Thermal shift assays to evaluate protein stability

  • Interaction Analysis:

    • Pull-down assays with other cytochrome c biogenesis components

    • Microscale thermophoresis to quantify binding affinities

    • Native gel electrophoresis to detect complex formation

These functional assays provide important insights into whether the recombinant protein retains its native activity and can successfully participate in cytochrome c biogenesis pathways.

How can Agrobacterium-mediated transformation be optimized for studying ccsA function in Cuscuta species?

Optimizing Agrobacterium-mediated transformation for Cuscuta species requires:

  • Strain Selection and Construct Design:

    • Both A. rhizogenes (MSU440) and A. tumefaciens (GV3101) strains show high transformation efficiency

    • Binary vectors with fluorescent markers facilitate tracking of transformation events

    • Use of strong promoters (35S or Ubiquitin) ensures good expression levels

  • Target Tissue Selection:

    • Focus on the adhesive disk region, particularly cells below the epidermis which show highest transformation competence

    • Young, actively growing tissue responds better to transformation

    • Pre-treatment with acetosyringone (100-200 μM) enhances transformation efficiency

  • Transformation Protocol:

    • Culture Agrobacterium in LB medium with appropriate antibiotics until OD600 = 0.8

    • Harvest Cuscuta shoots (~12 cm) and place in co-cultivation medium

    • Co-cultivation for 2-3 days at 21°C under continuous light

    • Transfer to selection medium containing appropriate antibiotics and cefotaxime to eliminate Agrobacterium

  • Analysis Methods:

    • Fluorescence microscopy to detect transformed cells (abundant in the cell layer below the adhesive disk's epidermis)

    • PCR verification of transgene integration

    • RT-PCR or qPCR to measure transgene expression levels

    • Maintain explants in vitro for several weeks to assess stability of transformation

This transformation protocol enables functional studies of ccsA through approaches like protein localization, promoter analysis, or gene silencing, providing valuable insights into the role of this protein in the parasitic lifestyle of Cuscuta.

What considerations should be taken into account when designing studies to investigate ccsA's role in cytochrome c maturation?

When designing studies to investigate ccsA's role in cytochrome c maturation, researchers should consider:

  • System Selection:

    • In vitro reconstitution systems using purified components

    • Heterologous expression in E. coli or yeast cytochrome c biogenesis mutants

    • Transformed Cuscuta tissue for in planta studies

    • Comparative studies across multiple Cuscuta species with varying host specificities

  • Experimental Controls:

    • Site-directed mutagenesis of conserved residues as negative controls

    • Complementation with known functional ccsA homologs as positive controls

    • Analysis of cytochrome c levels in transformed vs. non-transformed tissues

  • Technical Challenges:

    • Membrane protein expression and solubilization issues

    • Potential toxicity when overexpressed

    • Need for partner proteins in functional assays

    • Limited regeneration capacity of Cuscuta in vitro

  • Data Interpretation:

    • Account for potential pleiotropic effects due to disruption of electron transport

    • Consider physiological relevance of in vitro findings to in planta function

    • Evaluate results in context of the unique parasitic lifestyle of Cuscuta

By addressing these considerations, researchers can design robust studies that provide meaningful insights into the role of ccsA in cytochrome c maturation specifically within the context of parasitic plant biology and evolution.

What are the potential applications of understanding ccsA function in developing control strategies for parasitic Cuscuta species?

Understanding ccsA function could lead to several control strategies for Cuscuta infestations:

  • Targeted Inhibitors:

    • Development of small molecule inhibitors specific to Cuscuta ccsA

    • Design of peptide mimetics that interfere with ccsA-protein interactions

    • Creation of RNA interference (RNAi) constructs targeting ccsA expression

  • Host Resistance Enhancement:

    • Engineering crop plants to express antibodies or aptamers against ccsA

    • Development of decoy proteins that sequester ccsA or its interacting partners

    • Creation of trap crops that induce but do not support Cuscuta attachment

  • Biological Control Approaches:

    • Identification of microorganisms that target ccsA function

    • Development of biocontrol agents that disrupt cytochrome c biogenesis in Cuscuta

    • Engineering phages or other delivery systems for anti-ccsA compounds

  • Monitoring and Detection:

    • Development of antibody-based field tests for early detection of Cuscuta

    • Creation of biosensors that detect ccsA or its products in the environment

    • Remote sensing methods based on spectral signatures related to cytochrome content

Given that Cuscuta species pose significant threats to many agroecosystems worldwide , these approaches could provide sustainable and targeted control methods that specifically disrupt the parasitic plant's energy metabolism without affecting crop plants.

How might comparative genomics and proteomics approaches advance our understanding of ccsA evolution in parasitic plants?

Comparative genomics and proteomics approaches offer powerful insights into ccsA evolution:

  • Evolutionary Analysis:

    • Whole genome sequencing of multiple Cuscuta species to track ccsA gene evolution

    • Identification of selective pressures acting on ccsA across parasitic and non-parasitic lineages

    • Detection of horizontal gene transfer events affecting cytochrome c biogenesis pathways

  • Structural Proteomics:

    • Comparative modeling of ccsA proteins across species to identify conserved functional domains

    • Analysis of protein-protein interaction networks across different plant lineages

    • Investigation of post-translational modifications specific to parasitic plant ccsA

  • Functional Genomics:

    • Transcriptome analysis during host attachment and feeding to identify ccsA regulation

    • CRISPR-based genome editing to create ccsA variants for functional testing

    • Epigenetic profiling to understand regulation of ccsA expression during parasitism

  • Data Integration:

    • Multi-omics approaches combining genomics, transcriptomics, and proteomics data

    • Phylogenetic network analysis to track co-evolution of ccsA with other biogenesis components

    • Machine learning approaches to identify patterns in ccsA sequence related to host specificity

The recent publication of genomes for Cuscuta species provides an excellent foundation for these comparative approaches, which could reveal how ccsA has adapted during the evolution of parasitism and potentially identify targets for intervention.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.